GPAT3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GPAT3 Polyclonal antibody (30765-1-AP)

GPAT3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 30765-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

AGPAT9, 1 AGP acyltransferase 9, 1 AGPAT 9, 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 10, 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 9

• 

  WB analysis using 30765-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30765-1-AP (GPAT3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 30765-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30765-1-AP (GPAT3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HT-1080 using 30765-1-AP

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 30765-1-AP (GPAT3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 30765-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 30765-1-AP (GPAT3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 30765-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 30765-1-AP (GPAT3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 30765-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 30765-1-AP (GPAT3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 30765-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 30765-1-AP (GPAT3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 30765-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 30765-1-AP (GPAT3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GPAT3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, HT-1080 cells, A375 cells, Jurkat cells, MKN-45 cells
• Positive IHC detected in: mouse liver tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30765-1-AP targets GPAT3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33717

  Product name: Recombinant human GPAT3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 35-136 aa of Glycerol-3-phosphate acyltransferase 3

  Sequence: SEIYMKILVKTLEWATIRIEKGTPKESILKNSASVGIIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEELVSWNLLTRTNVNFQY*

• Full Name: 1-acylglycerol-3-phosphate O-acyltransferase 9
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: Glycerol-3-phosphate acyltransferase 3
• Gene Symbol: AGPAT9
• Gene ID (NCBI): 84803
• RRID: AB_3086413
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q53EU6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPAT3, also known as AGPAT9, is a member of the lysophosphatidic acid acyltransferase protein family. GPAT3 is an enzyme that catalyzes the conversion of glycerol-3-phosphate to lysophosphatidic acid in the synthesis of triacylglycerol.

Publications

What published studies show

The GPAT3 Polyclonal antibody (Cat# 30765-1-AP) has 1 total citation. It appears in Scientific Reports (2025), in a study investigating how AP-1 elements in the promoter and second intron mediate endoplasmic reticulum stress-induced expression of the GPAT3 gene. The research field encompasses transcriptional regulation, endoplasmic reticulum stress response, and lipid metabolism. The cited application was Western blot in human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Rep; AP-1 elements in the promoter and second intron mediate endoplasmic reticulum stress-induced expression of the GPAT3 gene.; Authors - Daima Örd