Glypican 3 Polyclonal antibody, PBS Only

Glypican 3 Polyclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 30021-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

GPC3, DGSX, Glypican-3 alpha subunit, Glypican-3 beta subunit, GTR2 2

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

30021-1-PBS targets Glypican 3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag32559

Product name: Recombinant human GPC3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 415-554 aa of BC035972

Sequence: VAENDTLCWNGQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHN

Predict reactive species
Full Name glypican 3
Calculated Molecular Weight 580 aa, 66 kDa
Observed Molecular Weight66 kDa
GenBank Accession NumberBC035972
Gene Symbol GPC3
Gene ID (NCBI) 2719
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP51654
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Glypicans (GPCs) are a family of glycosylphosphatidylinositol (GPI)-anchored heparan sulfate proteoglycans (HSPGs) that may play a role in the control of cell division and growth regulation. In mammals, there are six GPCs (GPC1 to GPC6), all of which have a similar core-protein size of approx. 60 kDa and the clustering of glycosaminoglycan attachment site near the C-terminus. They are tethered to the cell surface by GPI linkages, which can be cleaved by endogenous phospholipases, thus releasing the protein. Glypican 3 (GPC3) is highly expressed in many tissues during development and plays an important role in the regulation of embryonic growth (PMID: 22467855). Loss-of-function mutations of GPC3 result in the Simpson-Golabi-Behmel overgrowth syndrome (SGBS), and Gpc-3 null mice display developmental overgrowth (PMID: 8589713; 18477453). In hepatocellular carcinoma (HCC), the overexpression of glypican 3 has been demonstrated to be a reliable diagnostic indicator (PMID: 19212669; 22706665). The calculated molecular weight of native glypican 3 is 66 kDa, and glycinate forms of glypican 3 have higher molecular weights than 66 kDa (PMID: 12851874; 16024626; 19574424).

Loading...
||
New chat Able
正在加载,请稍候...