Glypican 3 Polyclonal antibody

Glypican 3 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 30021-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

GPC3, DGSX, Glypican-3 alpha subunit, Glypican-3 beta subunit, GTR2 2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHuH-7 cells
Positive IHC detected inhuman hepatocellular carcinoma
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

30021-1-AP targets Glypican 3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag32559

Product name: Recombinant human GPC3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 415-554 aa of BC035972

Sequence: VAENDTLCWNGQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHN

Predict reactive species
Full Name glypican 3
Calculated Molecular Weight 580 aa, 66 kDa
Observed Molecular Weight66 kDa
GenBank Accession NumberBC035972
Gene Symbol GPC3
Gene ID (NCBI) 2719
RRIDAB_2935499
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP51654
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glypicans (GPCs) are a family of glycosylphosphatidylinositol (GPI)-anchored heparan sulfate proteoglycans (HSPGs) that may play a role in the control of cell division and growth regulation. In mammals, there are six GPCs (GPC1 to GPC6), all of which have a similar core-protein size of approx. 60 kDa and the clustering of glycosaminoglycan attachment site near the C-terminus. They are tethered to the cell surface by GPI linkages, which can be cleaved by endogenous phospholipases, thus releasing the protein. Glypican 3 (GPC3) is highly expressed in many tissues during development and plays an important role in the regulation of embryonic growth (PMID: 22467855). Loss-of-function mutations of GPC3 result in the Simpson-Golabi-Behmel overgrowth syndrome (SGBS), and Gpc-3 null mice display developmental overgrowth (PMID: 8589713; 18477453). In hepatocellular carcinoma (HCC), the overexpression of glypican 3 has been demonstrated to be a reliable diagnostic indicator (PMID: 19212669; 22706665). The calculated molecular weight of native glypican 3 is 66 kDa, and glycinate forms of glypican 3 have higher molecular weights than 66 kDa (PMID: 12851874; 16024626; 19574424).

Protocols

Product Specific Protocols
WB protocol for Glypican 3 antibody 30021-1-APDownload protocol
IHC protocol for Glypican 3 antibody 30021-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIHC

Mol Cancer Res

METTL3-mediated m6A modification regulates the polycomb repressive complex 1 (PRC1) components BMI1 and RNF2 in hepatocellular carcinoma cells

Authors - Tong Wu
mouseWB

J Hazard Mater

Diesel exhaust promoted diethylnitrosamine-induced hepatocarcinogenesis in mice

Authors - Junjie Dou
Loading...
||
New chat Able
正在加载,请稍候...