Tested Applications
| Positive IHC detected in | mouse liver tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16334-1-AP targets GPR146 in IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9456 Product name: Recombinant human GPR146 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 211-333 aa of BC014241 Sequence: SRVRREDTPLDRDTGRLEPSAHRLLVATVCTQFGLWTPHYLILLGHTVIISRGKPVDAHYLGLLHFVKDFSKLLAFSSSFVTPLLYRYMNQSFPSKLQRLMKKLPCGDRHCSPDHMGVQQVLA Predict reactive species |
| Full Name | G protein-coupled receptor 146 |
| Calculated Molecular Weight | 333 aa, 37 kDa |
| GenBank Accession Number | BC014241 |
| Gene Symbol | GPR146 |
| Gene ID (NCBI) | 115330 |
| RRID | AB_3669240 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96CH1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
As a member of GPCRs, GPR146 (G protein-coupled receptor 146) was initially discovered as a c-peptide signal body. GPR146 may act as a c peptide receptor to interact with proinsulin c-peptide to regulate insulin levels (PMID: 37926274). Mechanically, GPR146 induces hepatic sterol regulatory element binding protein 2 (SREBP2) via the activation of extracellular signal-regulated kinase 1/2 (ERK1/2) signaling, consequently resulting in hepatic low-density lipoprotein (VLDL) secretion (PMID: 32491159).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GPR146 antibody 16334-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



