GPR161 Polyclonal antibody

GPR161 Polyclonal Antibody for WB, IF/ICC, ELISA
Cat No. 29328-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, IF/ICC, ELISA

FLJ33952, G protein coupled receptor 161, G protein coupled receptor RE2, GPR161, RE2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue
Positive IF/ICC detected inARPE-19 cells, hTERT-RPE1 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

29328-1-AP targets GPR161 in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag30998

Product name: Recombinant human GPR161 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 362-460 aa of BC028163

Sequence: SNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLEDYTSDDNPPSHCTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLD

Predict reactive species
Full Name G protein-coupled receptor 161
Calculated Molecular Weight 529 aa, 59 kDa
Observed Molecular Weight70 kDa
GenBank Accession NumberBC028163
Gene Symbol GPR161
Gene ID (NCBI) 23432
RRIDAB_3086118
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8N6U8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPR161 (also known as RE2) is an orphan G protein-coupled receptor and plays an important role in the Hh pathway. In the absence of Hh signals, GPR161 localizes to primary cilia and keeps the downstream GLI transcription factors in their repressor forms (PMID: 26305592). Ciliary localization of GPR161 requires TULP3 and the IFT-A complex. In the presence of SHH, GPR161 is removed from primary cilia and is internalized into recycling endosomes, preventing its activity and allowing activation of the Shh signaling. GPR161 has a calculated molecular mass of 59 kDa. The 70-kDa band detected by this antibody probably represents a modified version of GPR161 (PMID: 18250320).

Protocols

Product Specific Protocols
IF protocol for GPR161 antibody 29328-1-APDownload protocol
WB protocol for GPR161 antibody 29328-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

bioRxiv

Tulp3 quantitative alleles titrate requirements for viability, brain development, and kidney homeostasis but do not suppress Zfp423 mutations in mice

Authors - Corinne A McCoy

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Charlotte (Verified Customer) (07-25-2024)

I initially used GPR161 #13398-1-AP but it didn't worked at all in our NIH-3T3 nor in RPE1, nor in IMCD3 cells. So the company suggested this one and it worked nicely in IMCD3 (cf images GPR161 in green, ARL13B in red). It works a little less nicely in NIH-3T3 cells. I followed this protocol : remove medium add PFA 4% leave it 10 min wash 1xPBS add methanol in the freezer for 5min wash 2xPBS add blocking solution (1%BSA in PBST) leave it 1 hour add primary antibodies 1/400 wash 5x5min add secondary antibodies 1/500 wash 5x5min leave it in PBS image

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1/400
  • Cell Tissue Type: IMCD3
GPR161 Antibody Immunofluorescence validation (1/400 dilution) in IMCD3 (Cat no:29328-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...