Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IF/ICC detected in | ARPE-19 cells, hTERT-RPE1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
29328-1-AP targets GPR161 in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.
| Tested Reactivity | Human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30998 Product name: Recombinant human GPR161 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 362-460 aa of BC028163 Sequence: SNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLEDYTSDDNPPSHCTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLD Predict reactive species |
| Full Name | G protein-coupled receptor 161 |
| Calculated Molecular Weight | 529 aa, 59 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC028163 |
| Gene Symbol | GPR161 |
| Gene ID (NCBI) | 23432 |
| RRID | AB_3086118 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8N6U8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GPR161 (also known as RE2) is an orphan G protein-coupled receptor and plays an important role in the Hh pathway. In the absence of Hh signals, GPR161 localizes to primary cilia and keeps the downstream GLI transcription factors in their repressor forms (PMID: 26305592). Ciliary localization of GPR161 requires TULP3 and the IFT-A complex. In the presence of SHH, GPR161 is removed from primary cilia and is internalized into recycling endosomes, preventing its activity and allowing activation of the Shh signaling. GPR161 has a calculated molecular mass of 59 kDa. The 70-kDa band detected by this antibody probably represents a modified version of GPR161 (PMID: 18250320).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GPR161 antibody 29328-1-AP | Download protocol |
| WB protocol for GPR161 antibody 29328-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Charlotte (Verified Customer) (07-25-2024) | I initially used GPR161 #13398-1-AP but it didn't worked at all in our NIH-3T3 nor in RPE1, nor in IMCD3 cells. So the company suggested this one and it worked nicely in IMCD3 (cf images GPR161 in green, ARL13B in red). It works a little less nicely in NIH-3T3 cells. I followed this protocol : remove medium add PFA 4% leave it 10 min wash 1xPBS add methanol in the freezer for 5min wash 2xPBS add blocking solution (1%BSA in PBST) leave it 1 hour add primary antibodies 1/400 wash 5x5min add secondary antibodies 1/500 wash 5x5min leave it in PBS image
![]() |








