Product Information
29328-1-PBS targets GPR161 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag30998 Product name: Recombinant human GPR161 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 362-460 aa of BC028163 Sequence: SNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLEDYTSDDNPPSHCTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLD Predict reactive species |
Full Name | G protein-coupled receptor 161 |
Calculated Molecular Weight | 529 aa, 59 kDa |
Observed Molecular Weight | 70 kDa |
GenBank Accession Number | BC028163 |
Gene Symbol | GPR161 |
Gene ID (NCBI) | 23432 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8N6U8 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
GPR161 (also known as RE2) is an orphan G protein-coupled receptor and plays an important role in the Hh pathway. In the absence of Hh signals, GPR161 localizes to primary cilia and keeps the downstream GLI transcription factors in their repressor forms (PMID: 26305592). Ciliary localization of GPR161 requires TULP3 and the IFT-A complex. In the presence of SHH, GPR161 is removed from primary cilia and is internalized into recycling endosomes, preventing its activity and allowing activation of the Shh signaling. GPR161 has a calculated molecular mass of 59 kDa. The 70-kDa band detected by this antibody probably represents a modified version of GPR161 (PMID: 18250320).