GPR161 Polyclonal antibody, PBS Only

GPR161 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 29328-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

29328-1-PBS targets GPR161 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag30998

Product name: Recombinant human GPR161 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 362-460 aa of BC028163

Sequence: SNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLEDYTSDDNPPSHCTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLD

Predict reactive species
Full Name G protein-coupled receptor 161
Calculated Molecular Weight 529 aa, 59 kDa
Observed Molecular Weight70 kDa
GenBank Accession NumberBC028163
Gene Symbol GPR161
Gene ID (NCBI) 23432
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8N6U8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GPR161 (also known as RE2) is an orphan G protein-coupled receptor and plays an important role in the Hh pathway. In the absence of Hh signals, GPR161 localizes to primary cilia and keeps the downstream GLI transcription factors in their repressor forms (PMID: 26305592). Ciliary localization of GPR161 requires TULP3 and the IFT-A complex. In the presence of SHH, GPR161 is removed from primary cilia and is internalized into recycling endosomes, preventing its activity and allowing activation of the Shh signaling. GPR161 has a calculated molecular mass of 59 kDa. The 70-kDa band detected by this antibody probably represents a modified version of GPR161 (PMID: 18250320).

Loading...
||
New chat Able
正在加载,请稍候...