Tested Applications
Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
20307-1-AP targets GPR171 in IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14141 Product name: Recombinant human GPR171 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 239-319 aa of BC036815 Sequence: YHIVRIPYTLSQTEVITDCSTRISLFKAKEATLLLAVSNLCFDPVLYYHLSKAFRSKVTETFASPKETKAQKEKLRCENNA Predict reactive species |
Full Name | G protein-coupled receptor 171 |
Calculated Molecular Weight | 319 aa, 37 kDa |
GenBank Accession Number | BC036815 |
Gene Symbol | GPR171 |
Gene ID (NCBI) | 29909 |
RRID | AB_2878669 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O14626 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for GPR171 antibody 20307-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |