Tested Applications
Positive IHC detected in | mouse brain tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IHC | See 1 publications below |
Product Information
20847-1-AP targets GPR3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14257 Product name: Recombinant human GPR3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 271-330 aa of BC032702 Sequence: DAHSPPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRSRSPSDV Predict reactive species |
Full Name | G protein-coupled receptor 3 |
Calculated Molecular Weight | 330 aa, 35 kDa |
GenBank Accession Number | BC032702 |
Gene Symbol | GPR3 |
Gene ID (NCBI) | 2827 |
RRID | AB_2878749 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P46089 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GPR3 (G protein-coupled receptor 3) was first cloned from a mouse cDNA library in 1993 before being cloned from human genomic libraries by several independent groups (PMID: 29941868). GPR3 mRNA is broadly expressed in neurons in various brain regions, including the cortex, thalamus, hypothalamus, amygdala, hippocampus, pituitary, and cerebellum (PMID: 22207171). Moreover, the GPR3 protein is overexpressed in neurons in post-mortem brain tissue sections from individuals afflicted by Alzheimer's disease (PMID: 19213921).
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for GPR3 antibody 20847-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Oral Oncol The circadian clock gene, BMAL1, promotes radiosensitization in nasopharyngeal carcinoma by inhibiting the epithelial-to-mesenchymal transition via the TGF-β1/Smads/Snail1 axis |