GPR3 Polyclonal antibody

GPR3 Polyclonal Antibody for IHC, ELISA
Cat No. 20847-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

ACCA, ACCA orphan receptor, G protein coupled receptor 3, GPR3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inmouse brain tissue, human kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20847-1-AP targets GPR3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14257

Product name: Recombinant human GPR3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 271-330 aa of BC032702

Sequence: DAHSPPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRSRSPSDV

Predict reactive species
Full Name G protein-coupled receptor 3
Calculated Molecular Weight 330 aa, 35 kDa
GenBank Accession NumberBC032702
Gene Symbol GPR3
Gene ID (NCBI) 2827
RRIDAB_2878749
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP46089
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPR3 (G protein-coupled receptor 3) was first cloned from a mouse cDNA library in 1993 before being cloned from human genomic libraries by several independent groups (PMID: 29941868). GPR3 mRNA is broadly expressed in neurons in various brain regions, including the cortex, thalamus, hypothalamus, amygdala, hippocampus, pituitary, and cerebellum (PMID: 22207171). Moreover, the GPR3 protein is overexpressed in neurons in post-mortem brain tissue sections from individuals afflicted by Alzheimer's disease (PMID: 19213921).

Protocols

Product Specific Protocols
IHC protocol for GPR3 antibody 20847-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

iScience

Iloprost requires the Frizzled-9 receptor to prevent lung cancer.

Authors - Kayla Sompel
WB,IHC

Oral Oncol

The circadian clock gene, BMAL1, promotes radiosensitization in nasopharyngeal carcinoma by inhibiting the epithelial-to-mesenchymal transition via the TGF-β1/Smads/Snail1 axis

Authors - Yuxin Li
Loading...
||
New chat Able
正在加载,请稍候...