GPR3 Polyclonal antibody

• 

  IHC staining of mouse brain using 20847-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 20847-1-AP (GPR3 antibody) at dilution of 1:50 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 20847-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 20847-1-AP (GPR3 antibody) at dilution of 1:50 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 20847-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 20847-1-AP (GPR3 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 20847-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 20847-1-AP (GPR3 Antibody) at dilution of 1:50 (under 40x lens).

GPR3 Polyclonal Antibody for IHC, ELISA

Cat No. 20847-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

ACCA, ACCA orphan receptor, G protein coupled receptor 3, GPR3

---

Tested Applications

• Positive IHC detected in: mouse brain tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

20847-1-AP targets GPR3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14257

  Product name: Recombinant human GPR3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 271-330 aa of BC032702

  Sequence: DAHSPPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRSRSPSDV

• Full Name: G protein-coupled receptor 3
• Calculated Molecular Weight: 330 aa, 35 kDa
• GenBank Accession Number: BC032702
• Gene Symbol: GPR3
• Gene ID (NCBI): 2827
• RRID: AB_2878749
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P46089
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPR3 (G protein-coupled receptor 3) was first cloned from a mouse cDNA library in 1993 before being cloned from human genomic libraries by several independent groups (PMID: 29941868). GPR3 mRNA is broadly expressed in neurons in various brain regions, including the cortex, thalamus, hypothalamus, amygdala, hippocampus, pituitary, and cerebellum (PMID: 22207171). Moreover, the GPR3 protein is overexpressed in neurons in post-mortem brain tissue sections from individuals afflicted by Alzheimer's disease (PMID: 19213921).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		iScience; Iloprost requires the Frizzled-9 receptor to prevent lung cancer.; Authors - Kayla Sompel
	WB,IHC	Oral Oncol; The circadian clock gene, BMAL1, promotes radiosensitization in nasopharyngeal carcinoma by inhibiting the epithelial-to-mesenchymal transition via the TGF-β1/Smads/Snail1 axis; Authors - Yuxin Li