Tested Applications
| Positive IHC detected in | human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
Product Information
23326-1-AP targets GPR39 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19913 Product name: Recombinant human GPR39 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 336-453 aa of BC125046 Sequence: SSVINPLLYTVSSQQFRRVFVQVLCCRLSLQHANHEKRLRVHAHSTTDSARFVQRPLLFASRRQSSARRTEKIFLSTFQSEAEPQSKSQSLSLESLEPNSGAKPANSAAENGFQEHEV Predict reactive species |
| Full Name | G protein-coupled receptor 39 |
| Calculated Molecular Weight | 453 aa, 51 kDa |
| GenBank Accession Number | BC125046 |
| Gene Symbol | GPR39 |
| Gene ID (NCBI) | 2863 |
| RRID | AB_2879255 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43194 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GPR39 (G protein-coupled receptor 39), a member of the ghrelin family of G protein-coupled receptors, is zinc-responsive and contributes to the regulation of diverse neurovascular and neurologic functions (PMID: 34360964). GPR39 has relatively high ligand-independent constitutive activity, based on an aromatic cluster on the inner face of the extracellular ends of TM domains VI and VII, similar to other members of the ghrelin receptor family (PMID: 33918078).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GPR39 antibody 23326-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Zinc Alleviates Gut Barrier Dysfunction by Promoting the Methylation of AKT | ||
Int J Biochem Cell Biol The mechanism underlying the TC-G 1008 rescue of reactive oxygen species (ROS)-induced osteoblast apoptosis by the upregulation of peroxiredoxin 1 |



