Tested Applications
| Positive IHC detected in | mouse small intestine tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30863-1-AP targets GPR52 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31188 Product name: Recombinant human GPR52 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-65 aa of BC067456 Sequence: MNESRWTEWRILNMSSGIVNVSERHSCPLGFGHYSVVDVCIFETVVIVLLTFLIIAGNLTVIFVF Predict reactive species |
| Full Name | G protein-coupled receptor 52 |
| Calculated Molecular Weight | 361 aa, 41 kDa |
| GenBank Accession Number | BC067456 |
| Gene Symbol | GPR52 |
| Gene ID (NCBI) | 9293 |
| RRID | AB_3669768 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y2T5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GPR52, or G protein-coupled receptor 52, is an orphan G protein-coupled receptor (GPCR) that constitutively increases cellular cAMP levels and is coupled to the Gs protein, which activates adenylate cyclase. Agonism of GPR52 has been proposed as a therapeutic intervention for the psychotic and cognitive aspects of schizophrenia. Its role in modulating neurotransmission and the identification of ligands that can interact with it highlight its potential in therapeutic development.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GPR52 antibody 30863-1-AP | Download protocol |
| IHC protocol for GPR52 antibody 30863-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





