Product Information
17624-1-AP targets GPR61 in ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag11833 Product name: Recombinant human GPR61 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 351-451 aa of BC067464 Sequence: ELSKQFVCFFKPAPEKELRLPSREGSIEENFLQFLQGTGCPSESWVSRPLPSPKQEPPAVDFRIPGQIAEETSEFLEQQLTSDIIMSDSYLRPAASPRLES Predict reactive species |
Full Name | G protein-coupled receptor 61 |
Calculated Molecular Weight | 451 aa, 49 kDa |
GenBank Accession Number | BC067464 |
Gene Symbol | GPR61 |
Gene ID (NCBI) | 83873 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9BZJ8 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |