Tested Applications
Positive WB detected in | mouse kidney tissue, mouse liver tissue |
Positive IHC detected in | mouse pancreas tissue, human colon tissue, human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 3 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
Product Information
20146-1-AP targets GPR81 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag13682 Product name: Recombinant human GPR81 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 250-346 aa of BC066881 Sequence: SACDPSVHGALHITLSFTYMNSMLDPLVYYFSSPSFPKFYNKLKICSLKPKQPGHSKTQRPEEMPISNLGRRSCISVANSFQSQSDGQWDPHIVEWH Predict reactive species |
Full Name | G protein-coupled receptor 81 |
Calculated Molecular Weight | 346 aa, 39 kDa |
Observed Molecular Weight | 39 kDa |
GenBank Accession Number | BC066881 |
Gene Symbol | GPR81 |
Gene ID (NCBI) | 27198 |
RRID | AB_2878647 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9BXC0 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GPR81 (G protein-coupled receptor 81) is one of a large family of GPRs with low affinity for hydroxy-carboxylic acid structure ligands (PMID: 24657625). Lactate functions as a signaling molecule by serving as an agonist for the GPR81, involving both autocrine and paracrine mechanisms (PMID: 31836453). Moreover, A higher molecular mass band (∼60 kDa) is present in the brain and adipose tissue. This band is also strong in the transfected HeLa cells but weak in native HeLa cells and is therefore probably a form of GPR81, possibly a glycosylated form of the receptor (PMID: 23696276).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for GPR81 antibody 20146-1-AP | Download protocol |
IHC protocol for GPR81 antibody 20146-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Life Sci Aerobic exercise regulates GPR81 signal pathway and mediates complement- microglia axis homeostasis on synaptic protection in the early stage of Alzheimer's disease | ||
Front Oncol Lactate increases tumor malignancy by promoting tumor small extracellular vesicles production via the GPR81-cAMP-PKA-HIF-1α axis
| ||
Sci Rep PET-CT and RNA sequencing reveal novel targets for acupuncture-induced lowering of blood pressure in spontaneously hypertensive rats. | ||
Placenta Immunohistochemical localization of HCA1 receptor in placenta in presence of fetal growth restriction | ||
Adv Sci (Weinh) Breed-Driven Microbiome Heterogeneity Regulates Intestinal Stem Cell Proliferation via Lactobacillus-Lactate-GPR81 Signaling |