Tested Applications
| Positive WB detected in | mouse kidney tissue, mouse liver tissue |
| Positive IHC detected in | mouse pancreas tissue, human colon tissue, human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20146-1-AP targets GPR81 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13682 Product name: Recombinant human GPR81 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 250-346 aa of BC066881 Sequence: SACDPSVHGALHITLSFTYMNSMLDPLVYYFSSPSFPKFYNKLKICSLKPKQPGHSKTQRPEEMPISNLGRRSCISVANSFQSQSDGQWDPHIVEWH Predict reactive species |
| Full Name | G protein-coupled receptor 81 |
| Calculated Molecular Weight | 346 aa, 39 kDa |
| Observed Molecular Weight | 39 kDa |
| GenBank Accession Number | BC066881 |
| Gene Symbol | GPR81 |
| Gene ID (NCBI) | 27198 |
| RRID | AB_2878647 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BXC0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GPR81 (G protein-coupled receptor 81) is one of a large family of GPRs with low affinity for hydroxy-carboxylic acid structure ligands (PMID: 24657625). Lactate functions as a signaling molecule by serving as an agonist for the GPR81, involving both autocrine and paracrine mechanisms (PMID: 31836453). Moreover, A higher molecular mass band (∼60 kDa) is present in the brain and adipose tissue. This band is also strong in the transfected HeLa cells but weak in native HeLa cells and is therefore probably a form of GPR81, possibly a glycosylated form of the receptor (PMID: 23696276).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GPR81 antibody 20146-1-AP | Download protocol |
| WB protocol for GPR81 antibody 20146-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The GPR81 Polyclonal antibody (Cat# 20146-1-AP) has 13 citations across journals including Nature Communications, Advanced Science, Frontiers in Immunology, Life Sciences, Communications Biology, Scientific Reports, Experimental Neurology, Balkan Medical Journal, FASEB Journal, Frontiers in Oncology, Placenta, Antioxidants, and Neuroscience. Research fields span lactate-GPR81 signaling in cancer (breast, renal), Alzheimer's disease, neuroinflammation, hypertension, intestinal stem cells, acute lung injury, and placental/uterine biology, using WB, IHC, and IF.
| Species | Application | Title |
|---|---|---|
Nat Commun Lactate mitochondrial oxidation drives stemness potential in metastatic breast cancer. | ||
Adv Sci (Weinh) Breed-Driven Microbiome Heterogeneity Regulates Intestinal Stem Cell Proliferation via Lactobacillus-Lactate-GPR81 Signaling | ||
Front Immunol Casein hydrolysate promotes intestinal repair in adult mice with Salmonella enteritis through a lactate-GPR81-Wnt3A axis in intestinal stem cell niche. | ||
Life Sci Aerobic exercise regulates GPR81 signal pathway and mediates complement- microglia axis homeostasis on synaptic protection in the early stage of Alzheimer's disease | ||
Sci Rep PET-CT and RNA sequencing reveal novel targets for acupuncture-induced lowering of blood pressure in spontaneously hypertensive rats. |
