GPR81 Polyclonal antibody, PBS Only

• 

  WB analysis using 20146-1-AP (same clone as 20146-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20146-1-AP (GPR81 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20146-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 20146-1-AP (same clone as 20146-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 20146-1-AP (GPR81 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20146-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 20146-1-AP (same clone as 20146-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 20146-1-AP (GPR81 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20146-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 20146-1-AP (same clone as 20146-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 20146-1-AP (GPR81 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 20146-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 20146-1-AP (same clone as 20146-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 20146-1-AP (GPR81 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 20146-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 20146-1-AP (same clone as 20146-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 20146-1-AP (GPR81 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 20146-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 20146-1-AP (same clone as 20146-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 20146-1-AP (GPR81 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 20146-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GPR81 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 20146-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

FKSG80, G protein coupled receptor 104, G protein coupled receptor 81, GPR104, G-protein coupled receptor 104

---

Product Information

20146-1-PBS targets GPR81 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13682

  Product name: Recombinant human GPR81 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 250-346 aa of BC066881

  Sequence: SACDPSVHGALHITLSFTYMNSMLDPLVYYFSSPSFPKFYNKLKICSLKPKQPGHSKTQRPEEMPISNLGRRSCISVANSFQSQSDGQWDPHIVEWH

• Full Name: G protein-coupled receptor 81
• Calculated Molecular Weight: 346 aa, 39 kDa
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: BC066881
• Gene Symbol: GPR81
• Gene ID (NCBI): 27198
• RRID: AB_2878647
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BXC0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GPR81 (G protein-coupled receptor 81) is one of a large family of GPRs with low affinity for hydroxy-carboxylic acid structure ligands (PMID: 24657625). Lactate functions as a signaling molecule by serving as an agonist for the GPR81, involving both autocrine and paracrine mechanisms (PMID: 31836453). Moreover, A higher molecular mass band (∼60 kDa) is present in the brain and adipose tissue. This band is also strong in the transfected HeLa cells but weak in native HeLa cells and is therefore probably a form of GPR81, possibly a glycosylated form of the receptor (PMID: 23696276).