• Featured Product
  • KD/KO Validated

GPX4 Monoclonal antibody

GPX4 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 67763-1-Ig
Clone No.3F5G5

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig, rabbit, canine, chicken, zebrafish, hamster and More (4)

Applications

WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA

3F5G5, EC:1.11.1.12, EC:1.11.1.9, GPx 4, GPx-4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inEC109 cells, HEK-293 cells, NCCIT cells, pig brain tissue, rabbit testis tissue, Hela cells, HepG2 cells, Jurkat cells, HSC-T6 cells, 4T1 cells, ATDC-5 cells, MDCK cells, CHO cells, Chicken brain tissue, Zebrafish tissue, human platelet tissue, rat brain tissue, mouse brain tissue, rabbit brain tissue, rat testis tisssue, mouse testis tissue
Positive IHC detected inhuman liver cancer tissue, mouse testis tissue, rat testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse testis tissue
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67763-1-Ig targets GPX4 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, canine, chicken, zebrafish, hamster samples.

Tested Reactivity human, mouse, rat, pig, rabbit, canine, chicken, zebrafish, hamster
Cited Reactivityhuman, mouse, rat, pig, rabbit, chicken, bovine, sheep, goat, duck
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30650

Product name: Recombinant human GPX4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 107-197 aa of BC021567

Sequence: KQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF

Predict reactive species
Full Name glutathione peroxidase 4 (phospholipid hydroperoxidase)
Observed Molecular Weight 20-23 kDa
GenBank Accession NumberBC021567
Gene Symbol GPX4
Gene ID (NCBI) 2879
RRIDAB_2909469
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP36969
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPX4 (Phospholipid hydroperoxide glutathione peroxidase, mitochondrial) protects cells against membrane lipid peroxidation and cell death. Required for normal sperm development and male fertility.It has two isforms about 20KDa and 22KDa, respectively. GPX4 is a monomer,but it has a tendency to form higher mass oligomers (PMID:17630701). It presents primarily in testis.

Protocols

Product Specific Protocols
IF protocol for GPX4 antibody 67763-1-IgDownload protocol
IHC protocol for GPX4 antibody 67763-1-IgDownload protocol
WB protocol for GPX4 antibody 67763-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Cell Host Microbe

Liberation of daidzein by gut microbial β-galactosidase suppresses acetaminophen-induced hepatotoxicity in mice

Authors - Yunong Zeng
mouse,humanWB

Nucleic Acids Res

MEN1 is a regulator of alternative splicing and prevents R-loop-induced genome instability through suppression of RNA polymerase II elongation

Authors - Bangming Jin
humanWB

Adv Sci (Weinh)

Targeting GPX4 to Induce Ferroptosis Overcomes Chemoresistance Mediated by the PAX8-AS1/GPX4 Axis in Intrahepatic Cholangiocarcinoma

Authors - Zhi-Wen Chen
mouse,humanWB

J Adv Res

Modulation of Macrophage ferroptosis under the guide of infrared thermography promotes the healing of pressure injuries

Authors - Xiaoqiong Jiang
ratIF

Redox Biol

LOX-mediated ECM mechanical stress induces Piezo1 activation in hypoxic-ischemic brain damage and identification of novel inhibitor of LOX

Authors - Dongya Jiang
humanWB,IHC

Redox Biol

Targeting GPX4-mediated ferroptosis protection sensitizes BRCA1-deficient cancer cells to PARP inhibitors

Authors - Xuexia Xie

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Mounika (Verified Customer) (01-08-2026)

Western blot bands are excellent and brightness is wonderfull!

  • Applications: Western Blot, Immunohistochemistry
  • Primary Antibody Dilution: 1:1000
FH

Sai Sindhura (Verified Customer) (01-08-2026)

GPX4 antibody works very well

  • Applications: Western Blot, Immunoprecipitation
  • Primary Antibody Dilution: 1:5000
FH

Vignesh (Verified Customer) (11-07-2025)

Excellent antibody

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: 231 cells
FH

Prakash (Verified Customer) (10-28-2025)

It works very well in western blot

  • Applications: Western Blot
  • Cell Tissue Type: bladder cancer cell lines
FH

Pooja (Verified Customer) (09-08-2025)

mouse retina paraffin embedded section incubated with the GPx4 antibody (1:100 dilution) at 4 degree overnight.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Mouse retina
GPX4 Antibody Immunohistochemistry validation (1:100 dilution) in Mouse retina (Cat no:67763-1-Ig)
FH

Breanna (Verified Customer) (08-11-2025)

The antibody worked well when testing my GPX4 KO cells! Highly recommend.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
FH

Rajeshkumar (Verified Customer) (07-23-2025)

works very good for human and mic lysates

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
  • Primary Antibody Dilution: 1-1000
  • Cell Tissue Type: Human and mouse
FH

Vasu (Verified Customer) (09-23-2024)

We evaluated antibodies from various manufacturers but failed to achieve satisfactory results. However, using the ProteinTech antibody, we successfully detected robust and specific bands corresponding to the expected protein size.

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Flow Cytometry
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Breast Cancer and other cancer cells and tumor tissue samples
FH

Tianyi (Verified Customer) (08-17-2023)

Paraffine-embedded ovarian tissue (4% PFA, 24 h) incubated with GPX4 (1:200 dilution) and secondary antibody Alexa fluor donkey anti-mouse 647 IgG (H+L).

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Ovarian tissue
GPX4 Antibody Immunofluorescence validation (1:200 dilution) in Ovarian tissue (Cat no:67763-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...