Tested Applications
| Positive WB detected in | EC109 cells, HEK-293 cells, NCCIT cells, pig brain tissue, rabbit testis tissue, Hela cells, HepG2 cells, Jurkat cells, HSC-T6 cells, 4T1 cells, ATDC-5 cells, MDCK cells, CHO cells, Chicken brain tissue, Zebrafish tissue, human platelet tissue, rat brain tissue, mouse brain tissue, rabbit brain tissue, rat testis tisssue, mouse testis tissue |
| Positive IHC detected in | human liver cancer tissue, mouse testis tissue, rat testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse testis tissue |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 9 publications below |
| WB | See 723 publications below |
| IHC | See 148 publications below |
| IF | See 137 publications below |
| IP | See 10 publications below |
| CoIP | See 5 publications below |
Product Information
67763-1-Ig targets GPX4 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, canine, chicken, zebrafish, hamster samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit, canine, chicken, zebrafish, hamster |
| Cited Reactivity | human, mouse, rat, pig, rabbit, chicken, bovine, sheep, goat, duck |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30650 Product name: Recombinant human GPX4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 107-197 aa of BC021567 Sequence: KQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF Predict reactive species |
| Full Name | glutathione peroxidase 4 (phospholipid hydroperoxidase) |
| Observed Molecular Weight | 20-23 kDa |
| GenBank Accession Number | BC021567 |
| Gene Symbol | GPX4 |
| Gene ID (NCBI) | 2879 |
| RRID | AB_2909469 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P36969 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GPX4 (Phospholipid hydroperoxide glutathione peroxidase, mitochondrial) protects cells against membrane lipid peroxidation and cell death. Required for normal sperm development and male fertility.It has two isforms about 20KDa and 22KDa, respectively. GPX4 is a monomer,but it has a tendency to form higher mass oligomers (PMID:17630701). It presents primarily in testis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GPX4 antibody 67763-1-Ig | Download protocol |
| IHC protocol for GPX4 antibody 67763-1-Ig | Download protocol |
| WB protocol for GPX4 antibody 67763-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Host Microbe Liberation of daidzein by gut microbial β-galactosidase suppresses acetaminophen-induced hepatotoxicity in mice | ||
Nucleic Acids Res MEN1 is a regulator of alternative splicing and prevents R-loop-induced genome instability through suppression of RNA polymerase II elongation | ||
Adv Sci (Weinh) Targeting GPX4 to Induce Ferroptosis Overcomes Chemoresistance Mediated by the PAX8-AS1/GPX4 Axis in Intrahepatic Cholangiocarcinoma | ||
J Adv Res Modulation of Macrophage ferroptosis under the guide of infrared thermography promotes the healing of pressure injuries | ||
Redox Biol A potent phosphodiester Keap1-Nrf2 protein-protein interaction inhibitor as the efficient treatment of Alzheimer's disease | ||
Redox Biol LOX-mediated ECM mechanical stress induces Piezo1 activation in hypoxic-ischemic brain damage and identification of novel inhibitor of LOX |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Mounika (Verified Customer) (01-08-2026) | Western blot bands are excellent and brightness is wonderfull!
|
FH Sai Sindhura (Verified Customer) (01-08-2026) | GPX4 antibody works very well
|
FH Vignesh (Verified Customer) (11-07-2025) | Excellent antibody
|
FH Prakash (Verified Customer) (10-28-2025) | It works very well in western blot
|
FH Pooja (Verified Customer) (09-08-2025) | mouse retina paraffin embedded section incubated with the GPx4 antibody (1:100 dilution) at 4 degree overnight.
![]() |
FH Breanna (Verified Customer) (08-11-2025) | The antibody worked well when testing my GPX4 KO cells! Highly recommend.
|
FH Rajeshkumar (Verified Customer) (07-23-2025) | works very good for human and mic lysates
|
FH Vasu (Verified Customer) (09-23-2024) | We evaluated antibodies from various manufacturers but failed to achieve satisfactory results. However, using the ProteinTech antibody, we successfully detected robust and specific bands corresponding to the expected protein size.
|
FH Tianyi (Verified Customer) (08-17-2023) | Paraffine-embedded ovarian tissue (4% PFA, 24 h) incubated with GPX4 (1:200 dilution) and secondary antibody Alexa fluor donkey anti-mouse 647 IgG (H+L).
![]() |

































