Product Information
82949-3-PBS targets GPX4 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag5809 Product name: Recombinant human GPX4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC022071 Sequence: MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQ Predict reactive species |
Full Name | glutathione peroxidase 4 (phospholipid hydroperoxidase) |
Calculated Molecular Weight | 22 kDa |
GenBank Accession Number | BC022071 |
Gene Symbol | GPX4 |
Gene ID (NCBI) | 2879 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P36969 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |