Tested Applications
Positive WB detected in | PC-3 cells, Jurkat cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 1 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
IP | See 1 publications below |
Product Information
24299-1-AP targets GRAMD4 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag19140 Product name: Recombinant human GRAMD4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 479-578 aa of BC129837 Sequence: PTDYIRNGVLYVTENYLCFESSKSGSSKRNKVIKLVDITDIQKYKVLSVLPGSGMGIAVSTPSTQKPLVFGAMVHRDEAFETILSQYIKITSAAASGGDS Predict reactive species |
Full Name | GRAM domain containing 4 |
Calculated Molecular Weight | 578 aa, 66 kDa |
Observed Molecular Weight | 56, 60 kDa |
GenBank Accession Number | BC129837 |
Gene Symbol | GRAMD4 |
Gene ID (NCBI) | 23151 |
RRID | AB_2879482 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q6IC98 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GRAMD4 also termed as Death inducing protein is a 578 amino-acid protein, which contains 1 GRAM domain. GRAMD4 as a multi-pass membrane protein localizes in the Mitochondrion membrane. Overexpression of GRAMD4 results in a strong apoptotic response involving caspase-3 activation and cleavage of poly(ADP-ribose)-polymerase. GRAMD4 is expressed in lung and in primary lung squamous cell carcinoma (LSCC) and shows up-regulation in mitochondria by E2F-1 after addition of 4-hydroxytamoxifen. This evidence suggests that GRAMD4 may be a potential target for cancer therapies. Full-length GRAMD4 expresses a protein of 66 kDa, whereas the 255 bp-deletion mutant expresses a protein of 56 kDa (PMID: 21127500).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for GRAMD4 antibody 24299-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |