GRB10 Polyclonal antibody

• 

  WB analysis using 23591-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23591-1-AP (GRB10 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 23591-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 23591-1-AP (GRB10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 23591-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 23591-1-AP (GRB10 antibody) at dilution of 1:50 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 23591-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 23591-1-AP (GRB10 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 23591-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 23591-1-AP (GRB10 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 23591-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 23591-1-AP (GRB10 antibody) at dilution of 1:50 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 23591-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using GRB10 antibody (23591-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

GRB10 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 23591-1-AP

Publications(9)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Grb 10, GRB IR, GRB10, GRB10 adapter protein, GRBIR, IRBP, KIAA0207, MEG1, RSS

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, mouse brain tissue, mouse liver tissue, rat brain tissue
• Positive IHC detected in: human liver tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 9 publications below
• IHC: See 1 publications below

Product Information

23591-1-AP targets GRB10 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20355

  Product name: Recombinant human GRB10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-80 aa of BC024285

  Sequence: MNASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHILAVRRLQEEDQQFRTSSLPAI

• Full Name: growth factor receptor-bound protein 10
• Calculated Molecular Weight: 536aa,61 kDa; 594aa,67 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC024285
• Gene Symbol: GRB10
• Gene ID (NCBI): 2887
• RRID: AB_2879301
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13322
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GRB10 is an adapter protein which modulates coupling of a number of cell surface receptor kinases with specific signaling pathways. GRB10 has three consensus domains including pleckstrin homology (PH) domain, SH2/SH3 domain and Ras-associating domain. By binding to kinases, GRB10 suppresses signals from activated receptors tyrosine kinases, including INSR and IGF1R. It may play a role in mediating ubiquitination of INSR, leading to proteasomal degradation.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Res; Oncogenic AURKA-enhanced N6-methyladenosine modification increases DROSHA mRNA stability to transactivate STC1 in breast cancer stem-like cells.; Authors - Fei Peng
mouse	WB	J Clin Invest; TSC1 regulates the balance between effector and regulatory T cells.; Authors - Park Yoon Y
human	WB	Theranostics; PINCH-1 promotes IGF-1 receptor expression and skin cancer progression through inhibition of the GRB10-NEDD4 complex.; Authors - Xiaoxiao Wang
human	WB	Cancer Cell Int; GRB10 is a novel oncogene associated with cell proliferation and prognosis in glioma.; Authors - Yuanbing Chen
human	WB,IHC	Reproduction; MiR199a is implicated in embryo implantation by regulating Grb10 in rat.; Authors - Xia Hong-Fei HF
human	WB	DNA Cell Biol; Modulation of IGF1R Signaling Pathway by GIGYF1 in High Glucose-Induced SHSY-5Y Cells.; Authors - Ting Zhou

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Tongbin (Verified Customer) (08-25-2020)

This antibody detects a specific band of ~70 kDa, corresponding to predicted molecular weight of GRB10.

• Applications: Western Blot
• Cell Tissue Type: Heart