Product Information
23591-1-PBS targets GRB10 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20355 Product name: Recombinant human GRB10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC024285 Sequence: MNASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHILAVRRLQEEDQQFRTSSLPAI Predict reactive species |
| Full Name | growth factor receptor-bound protein 10 |
| Calculated Molecular Weight | 536aa,61 kDa; 594aa,67 kDa |
| Observed Molecular Weight | 60-70 kDa |
| GenBank Accession Number | BC024285 |
| Gene Symbol | GRB10 |
| Gene ID (NCBI) | 2887 |
| RRID | AB_2879301 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13322 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
GRB10 is an adapter protein which modulates coupling of a number of cell surface receptor kinases with specific signaling pathways. GRB10 has three consensus domains including pleckstrin homology (PH) domain, SH2/SH3 domain and Ras-associating domain. By binding to kinases, GRB10 suppresses signals from activated receptors tyrosine kinases, including INSR and IGF1R. It may play a role in mediating ubiquitination of INSR, leading to proteasomal degradation.













