GRB10 Polyclonal antibody, PBS Only

• 

  WB analysis using 23591-1-AP (same clone as 23591-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 23591-1-AP (GRB10 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23591-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 23591-1-AP (same clone as 23591-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 23591-1-AP (GRB10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23591-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 23591-1-AP (same clone as 23591-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 23591-1-AP (GRB10 antibody) at dilution of 1:50 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23591-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 23591-1-AP (same clone as 23591-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 23591-1-AP (GRB10 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23591-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 23591-1-AP (same clone as 23591-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 23591-1-AP (GRB10 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23591-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 23591-1-AP (same clone as 23591-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 23591-1-AP (GRB10 antibody) at dilution of 1:50 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23591-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 23591-1-AP (same clone as 23591-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using GRB10 antibody (23591-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 23591-1-PBS in a different storage buffer formulation.

GRB10 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 23591-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

23591-1-PBS targets GRB10 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20355

  Product name: Recombinant human GRB10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-80 aa of BC024285

  Sequence: MNASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHILAVRRLQEEDQQFRTSSLPAI

• Full Name: growth factor receptor-bound protein 10
• Calculated Molecular Weight: 536aa,61 kDa; 594aa,67 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC024285
• Gene Symbol: GRB10
• Gene ID (NCBI): 2887
• RRID: AB_2879301
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13322
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GRB10 is an adapter protein which modulates coupling of a number of cell surface receptor kinases with specific signaling pathways. GRB10 has three consensus domains including pleckstrin homology (PH) domain, SH2/SH3 domain and Ras-associating domain. By binding to kinases, GRB10 suppresses signals from activated receptors tyrosine kinases, including INSR and IGF1R. It may play a role in mediating ubiquitination of INSR, leading to proteasomal degradation.