GREM2 Polyclonal antibody, PBS Only

• 

  IHC staining of mouse ovary using 13892-1-AP (same clone as 13892-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 13892-1-AP (GREM2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13892-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse ovary using 13892-1-AP (same clone as 13892-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 13892-1-AP (GREM2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13892-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 13892-1-AP (same clone as 13892-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 13892-1-AP (GREM2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13892-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 13892-1-AP (same clone as 13892-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 13892-1-AP (GREM2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13892-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 13892-1-AP (same clone as 13892-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 13892-1-AP (GREM2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13892-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 13892-1-AP (same clone as 13892-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 13892-1-AP (GREM2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 13892-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 13892-1-AP (same clone as 13892-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 13892-1-AP (GREM2 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 13892-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 13892-1-AP (same clone as 13892-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 13892-1-AP (GREM2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 13892-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 13892-1-AP (same clone as 13892-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 13892-1-AP (GREM2 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 13892-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse kidney using 13892-1-AP (same clone as 13892-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse kidney tissue using GREM2 antibody (13892-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13892-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse ovary using 13892-1-AP (same clone as 13892-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse ovary tissue using GREM2 antibody (13892-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13892-1-PBS in a different storage buffer formulation.

GREM2 Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 13892-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, Indirect ELISA

Synonyms

---

Product Information

13892-1-PBS targets GREM2 in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4854

  Product name: Recombinant human GREM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-168 aa of BC046632

  Sequence: AIHSPYKDGSSNNSERWQHQIKEVLASSQEALVVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEESFQSCAFCKPQRVTSVLVELECPGLDPPFRLKKIQKVKQCRCMSVNLSDSDKQ

• Full Name: gremlin 2, cysteine knot superfamily, homolog (Xenopus laevis)
• Calculated Molecular Weight: 168 aa, 19 kDa
• GenBank Accession Number: BC046632
• Gene Symbol: GREM2
• Gene ID (NCBI): 64388
• RRID: AB_2877984
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H772
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.