Tested Applications
| Positive WB detected in | mouse cerebellum tissue, rat cerebellum tissue |
| Positive IHC detected in | human cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IHC | See 2 publications below |
Product Information
25779-1-AP targets GRIK1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22664 Product name: Recombinant human GRIK1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 837-905 aa of BC156975 Sequence: VAIGEFIYKSRKNNDIEQCLSFNAIMEELGISLKNQKKIKKKSRTKGKSSFTSILTCHQRRTQRKETVA Predict reactive species |
| Full Name | glutamate receptor, ionotropic, kainate 1 |
| Calculated Molecular Weight | 918 aa, 104 kDa |
| Observed Molecular Weight | 95-100 kDa |
| GenBank Accession Number | BC156975 |
| Gene Symbol | GRIK1 |
| Gene ID (NCBI) | 2897 |
| RRID | AB_2880236 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P39086 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GRIK1 antibody 25779-1-AP | Download protocol |
| WB protocol for GRIK1 antibody 25779-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Exp Ther Med Glutamate receptor ionotropic, kainate 1 serves as a novel tumor suppressor of colorectal carcinoma and predicts clinical prognosis. | ||
Oncol Res GRIK1 promotes glioblastoma malignancy and is a novel prognostic factor of poor prognosis |





