Tested Applications
Positive WB detected in | mouse cerebellum tissue, rat cerebellum tissue |
Positive IHC detected in | human cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IHC | See 2 publications below |
Product Information
25779-1-AP targets GRIK1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22664 Product name: Recombinant human GRIK1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 837-905 aa of BC156975 Sequence: VAIGEFIYKSRKNNDIEQCLSFNAIMEELGISLKNQKKIKKKSRTKGKSSFTSILTCHQRRTQRKETVA Predict reactive species |
Full Name | glutamate receptor, ionotropic, kainate 1 |
Calculated Molecular Weight | 918 aa, 104 kDa |
Observed Molecular Weight | 95-100 kDa |
GenBank Accession Number | BC156975 |
Gene Symbol | GRIK1 |
Gene ID (NCBI) | 2897 |
RRID | AB_2880236 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P39086 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for GRIK1 antibody 25779-1-AP | Download protocol |
IHC protocol for GRIK1 antibody 25779-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Exp Ther Med Glutamate receptor ionotropic, kainate 1 serves as a novel tumor suppressor of colorectal carcinoma and predicts clinical prognosis. | ||
Oncol Res GRIK1 promotes glioblastoma malignancy and is a novel prognostic factor of poor prognosis |