GRIK5 Polyclonal antibody

• 

  WB analysis using 28550-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28550-1-AP (GRIK5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 28550-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28550-1-AP (GRIK5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 28550-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28550-1-AP (GRIK5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

GRIK5 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28550-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat and More (1)

Applications

WB, IHC, ELISA

Synonyms

EAA2, Glutamate receptor KA 2, GRIK2, GRIK5, KA2

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

28550-1-AP targets GRIK5 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Cited Reactivity: mouse, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29363

  Product name: Recombinant human GRIK5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 845-980 aa of NM_001301030

  Sequence: MLQELRHAVSCRKTSRSRRRRRPGGPSRALLSLRAVREMRLSNGKLYSAGAGGDAGSAGGPQRLLDDPGPPSGARPAAPTPCTHVRVCQECRRIQALRASGAGAPPRGLGVPAEATSPPRPRPGPAGPRELAEHE

• Full Name: glutamate receptor, ionotropic, kainate 5
• Calculated Molecular Weight: 109 kDa
• Observed Molecular Weight: ~110 kDa
• GenBank Accession Number: NM_001301030
• Gene Symbol: GRIK5
• Gene ID (NCBI): 2901
• RRID: AB_3086064
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16478
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
zebrafish	WB	Acta Pharmacol Sin; Ursolic acid derivative UA312 ameliorates ionizing radiation-induced cardiotoxicity and neurodevelopmental toxicity in zebrafish via targeting chrna3 and grik5; Authors - Fei-Fei Xu
mouse	WB	Brain Res Bull; Pad2 Deletion Induces Anxiety‑like Behaviors and Memory Deficits in Mice; Authors - Xiaoqiang Lv