GRIM19 Monoclonal antibody, PBS Only (Capture/Detector)

• 

  WB analysis of LNCaP using 67414-1-Ig (same clone as 67414-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 67414-1-Ig (GRIM19 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67414-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67414-1-Ig (same clone as 67414-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67414-1-Ig (GRIM19 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67414-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67414-1-Ig (same clone as 67414-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67414-1-Ig (GRIM19 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67414-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67414-1-Ig (same clone as 67414-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67414-1-Ig (GRIM19 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67414-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67414-1-Ig (same clone as 67414-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67414-1-Ig (GRIM19 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67414-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67414-1-Ig (same clone as 67414-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67414-1-Ig (GRIM19 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67414-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67414-1-Ig (same clone as 67414-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67414-1-Ig (GRIM19 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67414-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67414-1-Ig (same clone as 67414-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67414-1-Ig (GRIM19 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67414-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP50735-1

  Cytometric bead array standard curve of MP50735-1, GRIM19 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67414-2-PBS. Detection antibody: 67414-1-PBS. Standard:Ag20855. Range: 0.098-100 ng/mL.

• 

  Cytometric bead array standard curve of MP50735-3

  Cytometric bead array standard curve of MP50735-3, GRIM19 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67414-1-PBS. Detection antibody: 67414-4-PBS. Standard:Ag20855. Range: 0.098-100 ng/mL.

GRIM19 Monoclonal Antibody for WB, IHC, Cytometric bead array, Indirect ELISA

Cat No. 67414-1-PBS

Clone No.3A10C5

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

Synonyms

NDUFA13, CI B16.6, CGI-39, CGI 39, Cell death regulatory protein GRIM-19

---

Product Information

67414-1-PBS targets GRIM19 as part of a matched antibody pair:

MP50735-1: 67414-2-PBS capture and 67414-1-PBS detection (validated in Cytometric bead array)

MP50735-3: 67414-1-PBS capture and 67414-4-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20855

  Product name: Recombinant human GRIM19 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-144 aa of BC009189

  Sequence: MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT

• Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13
• Calculated Molecular Weight: 16.5 kDa
• Observed Molecular Weight: 16-18 kDa
• GenBank Accession Number: BC009189
• Gene Symbol: GRIM19
• Gene ID (NCBI): 51079
• RRID: AB_2882654
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9P0J0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GRIM19(Gene associated with retinoic and interferon-induced mortality 19 protein) is also named as NDUFA13 ,CI-B16.6 and belongs to the complex I NDUFA13 subunit family.t GRIM-19 may distribute in the mitochondria and/or nucleus depending on the cell type.Alternatively, its cellular localization may be regulated by post-translational modifications such as phosphorylation and acetylation. Lastly, GRIM-19 may exist in different isoforms that may be distributed in distinct cellular locations(PMID:12628925).