GRIM19 Monoclonal antibody, PBS Only (Capture/Detector)

GRIM19 Monoclonal Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 67414-1-PBS
Clone No.3A10C5

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

NDUFA13, CI B16.6, CGI-39, CGI 39, Cell death regulatory protein GRIM-19

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67414-1-PBS targets GRIM19 as part of a matched antibody pair:

MP50735-1: 67414-2-PBS capture and 67414-1-PBS detection (validated in Cytometric bead array)

MP50735-3: 67414-1-PBS capture and 67414-4-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag20855

Product name: Recombinant human GRIM19 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-144 aa of BC009189

Sequence: MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT

Predict reactive species
Full Name NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13
Calculated Molecular Weight16.5 kDa
Observed Molecular Weight 16-18 kDa
GenBank Accession NumberBC009189
Gene Symbol GRIM19
Gene ID (NCBI) 51079
RRIDAB_2882654
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9P0J0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GRIM19(Gene associated with retinoic and interferon-induced mortality 19 protein) is also named as NDUFA13 ,CI-B16.6 and belongs to the complex I NDUFA13 subunit family.t GRIM-19 may distribute in the mitochondria and/or nucleus depending on the cell type.Alternatively, its cellular localization may be regulated by post-translational modifications such as phosphorylation and acetylation. Lastly, GRIM-19 may exist in different isoforms that may be distributed in distinct cellular locations(PMID:12628925).

Loading...
||
New chat Able
正在加载,请稍候...