GRIM19 Monoclonal antibody

• 

  WB analysis of LNCaP using 67414-1-Ig

  LNCaP cells were subjected to SDS PAGE followed by western blot with 67414-1-Ig (GRIM19 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 67414-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67414-1-Ig (GRIM19 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 67414-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67414-1-Ig (GRIM19 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 67414-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 67414-1-Ig (GRIM19 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 67414-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67414-1-Ig (GRIM19 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 67414-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67414-1-Ig (GRIM19 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 67414-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67414-1-Ig (GRIM19 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 67414-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67414-1-Ig (GRIM19 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

GRIM19 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67414-1-Ig

Clone No.3A10C5

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, IHC, ELISA

Synonyms

B16.6, CDA016, CGI 39, CI B16.6, Complex I B16.6, GRIM 19, GRIM19, NDUFA13

---

Tested Applications

• Positive WB detected in: LNCaP cells, HEK-293 cells, HeLa cells, HepG2 cells
• Positive IHC detected in: human liver cancer tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67414-1-Ig targets GRIM19 in WB, IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20855

  Product name: Recombinant human GRIM19 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-144 aa of BC009189

  Sequence: MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT

• Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13
• Calculated Molecular Weight: 16.5 kDa
• Observed Molecular Weight: 16-18 kDa
• GenBank Accession Number: BC009189
• Gene Symbol: GRIM19
• Gene ID (NCBI): 51079
• RRID: AB_2882654
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9P0J0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GRIM19(Gene associated with retinoic and interferon-induced mortality 19 protein) is also named as NDUFA13 ,CI-B16.6 and belongs to the complex I NDUFA13 subunit family.t GRIM-19 may distribute in the mitochondria and/or nucleus depending on the cell type.Alternatively, its cellular localization may be regulated by post-translational modifications such as phosphorylation and acetylation. Lastly, GRIM-19 may exist in different isoforms that may be distributed in distinct cellular locations(PMID:12628925).