Tested Applications
Positive WB detected in | SH-SY5Y cells |
Positive IHC detected in | human lung cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IHC | See 2 publications below |
Product Information
28482-1-AP targets GRP in WB, IHC, ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag29357 Product name: Recombinant human GRP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 49-120 aa of BC004488 Sequence: LMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFK Predict reactive species |
Full Name | gastrin-releasing peptide |
Calculated Molecular Weight | 16 kDa |
Observed Molecular Weight | 16-18 kDa |
GenBank Accession Number | BC004488 |
Gene Symbol | GRP |
Gene ID (NCBI) | 2922 |
RRID | AB_2881152 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P07492 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for GRP antibody 28482-1-AP | Download protocol |
IHC protocol for GRP antibody 28482-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Ann N Y Acad Sci The von Economo neurons in the frontoinsular and anterior cingulate cortex. | ||
Front Immunol A novel necroptosis-related gene index for predicting prognosis and a cold tumor immune microenvironment in stomach adenocarcinoma |