Tested Applications
| Positive WB detected in | SH-SY5Y cells |
| Positive IHC detected in | human lung cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IHC | See 2 publications below |
Product Information
28482-1-AP targets GRP in WB, IHC, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29357 Product name: Recombinant human GRP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 49-120 aa of BC004488 Sequence: LMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFK Predict reactive species |
| Full Name | gastrin-releasing peptide |
| Calculated Molecular Weight | 16 kDa |
| Observed Molecular Weight | 16-18 kDa |
| GenBank Accession Number | BC004488 |
| Gene Symbol | GRP |
| Gene ID (NCBI) | 2922 |
| RRID | AB_2881152 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P07492 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GRP antibody 28482-1-AP | Download protocol |
| WB protocol for GRP antibody 28482-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Ann N Y Acad Sci The von Economo neurons in the frontoinsular and anterior cingulate cortex. | ||
Front Immunol A novel necroptosis-related gene index for predicting prognosis and a cold tumor immune microenvironment in stomach adenocarcinoma |









