GRP Polyclonal antibody, PBS Only

• 

  WB analysis using 28482-1-AP (same clone as 28482-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 28482-1-AP (GRP antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28482-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 28482-1-AP (same clone as 28482-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 28482-1-AP (GRP antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28482-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 28482-1-AP (same clone as 28482-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 28482-1-AP (GRP antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28482-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 28482-1-AP (same clone as 28482-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 28482-1-AP (GRP antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28482-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 28482-1-AP (same clone as 28482-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 28482-1-AP (GRP antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28482-1-PBS in a different storage buffer formulation.

GRP Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 28482-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

28482-1-PBS targets GRP in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29357

  Product name: Recombinant human GRP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 49-120 aa of BC004488

  Sequence: LMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFK

• Full Name: gastrin-releasing peptide
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 16-18 kDa
• GenBank Accession Number: BC004488
• Gene Symbol: GRP
• Gene ID (NCBI): 2922
• RRID: AB_2881152
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07492
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.