Product Information
28482-1-PBS targets GRP in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag29357 Product name: Recombinant human GRP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 49-120 aa of BC004488 Sequence: LMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFK Predict reactive species |
Full Name | gastrin-releasing peptide |
Calculated Molecular Weight | 16 kDa |
Observed Molecular Weight | 16-18 kDa |
GenBank Accession Number | BC004488 |
Gene Symbol | GRP |
Gene ID (NCBI) | 2922 |
RRID | AB_2881152 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P07492 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |