BET1L Polyclonal antibody

• 

  WB analysis using 14163-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14163-1-AP (BET1L antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human cervical cancer using 14163-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 14163-1-AP (BET1L antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human cervical cancer using 14163-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 14163-1-AP (BET1L antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cervical cancer using 14163-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 14163-1-AP (BET1L antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse stomach using 14163-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 14163-1-AP (BET1L antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse stomach using 14163-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 14163-1-AP (BET1L antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

BET1L Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14163-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Vesicle transport protein GOS15, GS15, GOS-15, Golgi SNARE with a size of 15 kDa, BET1-like protein

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, MCF-7 cells
• Positive IHC detected in: human cervical cancer tissue, mouse stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14163-1-AP targets BET1L in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5351

  Product name: Recombinant human GS15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-102 aa of BC032779

  Sequence: MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMVRAHGVRVSVPCPSTTCCRACSVSFSTGAGGWSNHHFCVILLGFLP

• Full Name: blocked early in transport 1 homolog (S. cerevisiae)-like
• Calculated Molecular Weight: 102 aa, 11 kDa
• Observed Molecular Weight: 13-15 kDa
• GenBank Accession Number: BC032779
• Gene Symbol: BET1L
• Gene ID (NCBI): 51272
• RRID: AB_2064737
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NYM9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.