Tested Applications
Positive WB detected in | HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, MCF-7 cells |
Positive IHC detected in | human cervical cancer tissue, mouse stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
14163-1-AP targets BET1L in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag5351 Product name: Recombinant human GS15 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC032779 Sequence: MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMVRAHGVRVSVPCPSTTCCRACSVSFSTGAGGWSNHHFCVILLGFLP Predict reactive species |
Full Name | blocked early in transport 1 homolog (S. cerevisiae)-like |
Calculated Molecular Weight | 102 aa, 11 kDa |
Observed Molecular Weight | 13-15 kDa |
GenBank Accession Number | BC032779 |
Gene Symbol | BET1L |
Gene ID (NCBI) | 51272 |
RRID | AB_2064737 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NYM9 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for BET1L antibody 14163-1-AP | Download protocol |
IHC protocol for BET1L antibody 14163-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |