• Featured Product
  • KD/KO Validated

eRF3a/GSPT1 Polyclonal antibody

eRF3a/GSPT1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 10763-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

eRF3a, GSPT1, EC:3.6.5.-, ETF3A, Eukaryotic peptide chain release factor GTP-binding subunit ERF3A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HepG2 cells, MOLT-4 cells, Caco-2 cells, HCT 116 cells, HeLa cells
Positive IHC detected inhuman liver cancer tissue, mouse brain tissue, human lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10763-1-AP targets eRF3a/GSPT1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1184

Product name: Recombinant human GSPT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 265-633 aa of BC009503

Sequence: QEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYIGLPFIPYLDNLPNFNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD

Predict reactive species
Full Name G1 to S phase transition 1
Calculated Molecular Weight 68 aa, 4 kDa
Observed Molecular Weight 80-85 kDa
GenBank Accession NumberBC009503
Gene Symbol GSPT1
Gene ID (NCBI) 2935
RRIDAB_2115506
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP15170
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The eukaryotic Release Factor 3 (eRF3) is a GTPase that associates with eRF1 in a complex that mediates translation termination. Eukaryotic release factor 3 (eRF3) has many functions in eukaryotic cells, such as controlling the regulation of the cell cycle at the G1 to S phase transition, and regulating protein synthesis as a GTP dependent stimulator of eRF1 in translation termination. It was also reported to play a key role as an initiator of the mRNA degradation machinery in the recycling of ribosomes in successive cycles of translation,and probably also in transcription regulation. eRF3a, also known as GSPT1, is one subunit of eRF3(PMID:15917414,12923185). It involves in translation termination in response to the termination codons UAA, UAG and UGA and stimulates the activity of ERF1. eRF3a/GSPT1 exists some isoforms with MV 69 kDa and 56 kDa. Identification of a processed form of eRF3a/GSPT1 as a BIR3-binding protein-Using a GST-BIR3 fusion protein as an affinity reagent to purify new IAP binding proteins from extracts of human cells and mouse tissues, we previously isolated 3 proteins of molecular weights 23, 38 and 80 kDa. 80 kDa band confirmed that it is a processed form of the human GSPT1/eRF3a protein, lacking the first 69 residues(PMID: 12865429).

Protocols

Product Specific Protocols
IF protocol for eRF3a/GSPT1 antibody 10763-1-APDownload protocol
IHC protocol for eRF3a/GSPT1 antibody 10763-1-APDownload protocol
WB protocol for eRF3a/GSPT1 antibody 10763-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nature

A novel cereblon modulator recruits GSPT1 to the CRL4(CRBN) ubiquitin ligase.

Authors - Mary E Matyskiela
  • KD Validated
humanIF

Mol Cell

Spatiotemporal Proteomic Analysis of Stress Granule Disassembly Using APEX Reveals Regulation by SUMOylation and Links to ALS Pathogenesis.

Authors - Hagai Marmor-Kollet
mouse,humanWB

Mol Cell

Mammalian hyperplastic discs homolog EDD regulates miRNA-mediated gene silencing.

Authors - Hong Su
humanWB

Cell Rep Med

Development of an orally bioavailable CDK12/13 degrader and induction of synthetic lethality with AKT pathway inhibition

Authors - Yu Chang
humanWB,IF

Cardiovasc Res

Readthrough of nonsense mutation W822X in the SCN5A gene can effectively restore expression of cardiac Na+ channels.

Authors - Teng Siyong S
  • KD Validated
humanWB

J Biol Chem

A Novel Rac1-GSPT1 Signaling Pathway Controls Astrogliosis Following Central Nervous System Injury.

Authors - Taiji Ishii
Loading...
||
New chat

Able

正在加载,请稍候...