Tested Applications
| Positive WB detected in | HepG2 cells, HUVEC cells, Raji cells, L02 cells, mouse testis tissue, rat testis tissue |
| Positive IP detected in | Raji cells |
| Positive IHC detected in | human testis tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 8 publications below |
| IHC | See 3 publications below |
| IP | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
14535-1-AP targets GSTK1 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6036 Product name: Recombinant human GSTK1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-226 aa of BC050715 Sequence: MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL Predict reactive species |
| Full Name | glutathione S-transferase kappa 1 |
| Calculated Molecular Weight | 32 kDa |
| Observed Molecular Weight | 27 kDa |
| GenBank Accession Number | BC050715 |
| Gene Symbol | GSTK1 |
| Gene ID (NCBI) | 373156 |
| RRID | AB_2115910 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y2Q3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GSTK1, glutathione S-transferase kappa 1, belongs to the superfamily of glutathione S-transferase (GST), which is related to oxidative stress (PMID:16081649). GSTK1 expression is negatively correlated with obesity in mice and human, hypertrophic cardiomyopathy (PMID:21428694, PMID:27378925). GSTK1 was expressed in the peroxisomal and mitochondrial fractions and localized to peroxisomes (PubMed:14742434).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GSTK1 antibody 14535-1-AP | Download protocol |
| IP protocol for GSTK1 antibody 14535-1-AP | Download protocol |
| WB protocol for GSTK1 antibody 14535-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Proteome Res Proteomic Analysis of Hearts from Akita Mice Suggests Increases in Soluble Epoxide Hydrolase and Antioxidative Programming are Key Changes in Early Stages of Diabetic Cardiomyopathy. | ||
Exp Mol Pathol Aberrant expression of redox regulatory proteins in patients with concomitant primary Sclerosing cholangitis/inflammatory bowel disease. | ||
FASEB J The role of chemerin in the regulation of cGAS-STING pathway in gestational diabetes mellitus placenta | ||
Sci Total Environ m6A methylation-mediated PGC-1α contributes to ferroptosis via regulating GSTK1 in arsenic-induced hepatic insulin resistance |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH S (Verified Customer) (08-15-2024) | Excellent
![]() |
FH SD (Verified Customer) (07-05-2024) | Very good
![]() |
FH Andrea (Verified Customer) (01-23-2023) | Strong and specific signal.
|



















