• Featured Product
  • KD/KO Validated

GSTK1 Polyclonal antibody

GSTK1 Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 14535-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, CoIP, ELISA

DsbA-L, GST 13 13, GST, Glutathione S-transferase subunit 13, Glutathione S-transferase kappa 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HUVEC cells, Raji cells, L02 cells, mouse testis tissue, rat testis tissue
Positive IP detected inRaji cells
Positive IHC detected inhuman testis tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14535-1-AP targets GSTK1 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6036

Product name: Recombinant human GSTK1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-226 aa of BC050715

Sequence: MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL

Predict reactive species
Full Name glutathione S-transferase kappa 1
Calculated Molecular Weight 32 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC050715
Gene Symbol GSTK1
Gene ID (NCBI) 373156
RRIDAB_2115910
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y2Q3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GSTK1, glutathione S-transferase kappa 1, belongs to the superfamily of glutathione S-transferase (GST), which is related to oxidative stress (PMID:16081649). GSTK1 expression is negatively correlated with obesity in mice and human, hypertrophic cardiomyopathy (PMID:21428694, PMID:27378925). GSTK1 was expressed in the peroxisomal and mitochondrial fractions and localized to peroxisomes (PubMed:14742434).

Protocols

Product Specific Protocols
IHC protocol for GSTK1 antibody 14535-1-APDownload protocol
IP protocol for GSTK1 antibody 14535-1-APDownload protocol
WB protocol for GSTK1 antibody 14535-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

J Proteome Res

Proteomic Analysis of Hearts from Akita Mice Suggests Increases in Soluble Epoxide Hydrolase and Antioxidative Programming are Key Changes in Early Stages of Diabetic Cardiomyopathy.

Authors - Dewey Shannamar S
mouseWB

J Gerontol A Biol Sci Med Sci

PMID: 24285747

Authors - Rojanathammanee Lalida L
mouseWB

Age (Dordr)

PMID: 25001375

Authors - Lalida Rojanathammanee
humanWB

Exp Mol Pathol

Aberrant expression of redox regulatory proteins in patients with concomitant primary Sclerosing cholangitis/inflammatory bowel disease.

Authors - Dennis R Petersen
humanCoIP

FASEB J

The role of chemerin in the regulation of cGAS-STING pathway in gestational diabetes mellitus placenta

Authors - Xuan Zhou
human,ratWB

Sci Total Environ

m6A methylation-mediated PGC-1α contributes to ferroptosis via regulating GSTK1 in arsenic-induced hepatic insulin resistance

Authors - Jingyuan Zhang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

S (Verified Customer) (08-15-2024)

Excellent

  • Applications: Western Blot
  • Primary Antibody Dilution: 1000
  • Cell Tissue Type: A549
GSTK1 Antibody Western Blot validation (1000 dilution) in A549 (Cat no:14535-1-AP)
FH

SD (Verified Customer) (07-05-2024)

Very good

  • Applications: Western Blot
  • Primary Antibody Dilution: 1000
  • Cell Tissue Type: A549
GSTK1 Antibody Western Blot validation (1000 dilution) in A549 (Cat no:14535-1-AP)
FH

Andrea (Verified Customer) (01-23-2023)

Strong and specific signal.

  • Applications: Western Blot
Loading...
||
New chat Able
正在加载,请稍候...