GSTO1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GSTO1 Polyclonal antibody (15124-1-AP)

• Featured Product
• KD/KO Validated

GSTO1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15124-1-AP Copied!

Publications (17)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA
For FC, select conjugated version.

Synonyms

EC:1.20.4.2, EC:1.8.5.1, EC:2.5.1.18, glutathione S transferase omega 1, Glutathione S-transferase omega 1-1

• 

  WB analysis using 15124-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15124-1-AP (GSTO1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat brain using 15124-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 15124-1-AP (GSTO1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 15124-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15124-1-AP (GSTO1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 15124-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 15124-1-AP (GSTO1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of U-937 using 15124-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 15124-1-AP (GSTO1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Jurkat using 15124-1-AP

  IP result of anti-GSTO1 (IP:15124-1-AP, 4ug; Detection:15124-1-AP 1:500) with Jurkat cells lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 15124-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 15124-1-AP (GSTO1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 15124-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 15124-1-AP (GSTO1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of PC-3 using 15124-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using GSTO1 antibody (15124-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GSTO1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, rat brain tissue, mouse liver tissue, human heart tissue, U-937 cells, Jurkat cells, PC-3 cells
• Positive IP detected in: Jurkat cells
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15124-1-AP targets GSTO1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7199

  Product name: Recombinant human GSTO1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-241 aa of BC000127

  Sequence: MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL

• Full Name: glutathione S-transferase omega 1
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 27-30 kDa
• GenBank Accession Number: BC000127
• Gene Symbol: GSTO1
• Gene ID (NCBI): 9446
• RRID: AB_2248132
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P78417
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glutathione-S-transferase omega 1 (GSTO1) belongs to a new subfamily of GSTs and is the rate limiting enzyme for biotransformation of inorganic arsenic, environmental carcinogen. Expression of GSTO1-1 was abundant in a wide range of normal tissues, particularly liver, macrophages, glial cells, and endocrine cells. Human GSTO1 assembles as a dimer. This antibody detects both monomer (27-30 kDa) and dimer forms of GSTO1 (54-64 kDa). (PMID: 21495794)

Publications

What published studies show

GSTO1 Polyclonal antibody (Cat# 15124-1-AP) has 17 citations across journals including Molecular Cell, Nature Chemical Biology, Journal of Experimental Medicine, Oncogene, Journal of Proteome Research, and PLoS ONE. Research fields span ferroptosis, redox biology, inflammasome signaling, innate immunity, cancer (lung and bladder), renal ischemia, extracellular vesicles, neurotoxicity, carcinogenesis, insulin biosynthesis, and proteomics.

Automatically generated from the 17 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; SMURF2 predisposes cancer cell toward ferroptosis in GPX4-independent manners by promoting GSTP1 degradation; Authors - Wenxin Zhang
human	WB	Nat Chem Biol; Nucleophilic covalent ligand discovery for the cysteine redoxome; Authors - Ling Fu
mouse	WB,IF	J Exp Med; ASC deglutathionylation is a checkpoint for NLRP3 inflammasome activation.; Authors - Shuhang Li ; KO Validated
mouse,human	IF	J Neuroinflammation; The mouse retinal pigment epithelium mounts an innate immune defense response following retinal detachment; Authors - Steven F Abcouwer
pig	WB	Food Chem; TMT-based quantitative proteomic analysis of porcine muscle associated with postmortem meat quality.; Authors - Xinhua Hou
human	WB	Oncogene; GSTO1 aggravates EGFR-TKIs resistance and tumor metastasis via deglutathionylation of NPM1 in lung adenocarcinoma; Authors - Ning-Xiang Shen