• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated GSTO1 Polyclonal antibody

GSTO1 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-15124

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

EC:1.20.4.2, EC:1.8.5.1, EC:2.5.1.18, glutathione S transferase omega 1, Glutathione S-transferase omega 1-1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inPC-3 cells
Positive FC (Intra) detected inPC-3 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-15124 targets GSTO1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7199

Product name: Recombinant human GSTO1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-241 aa of BC000127

Sequence: MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL

Predict reactive species
Full Name glutathione S-transferase omega 1
Calculated Molecular Weight 28 kDa
Observed Molecular Weight 27-30 kDa
GenBank Accession NumberBC000127
Gene Symbol GSTO1
Gene ID (NCBI) 9446
RRIDAB_3672622
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP78417
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Glutathione-S-transferase omega 1 (GSTO1) belongs to a new subfamily of GSTs and is the rate limiting enzyme for biotransformation of inorganic arsenic, environmental carcinogen. Expression of GSTO1-1 was abundant in a wide range of normal tissues, particularly liver, macrophages, glial cells, and endocrine cells. Human GSTO1 assembles as a dimer. This antibody detects both monomer (27-30 kDa) and dimer forms of GSTO1 (54-64 kDa). (PMID: 21495794)

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 GSTO1 antibody CL488-15124Download protocol
IF protocol for CL Plus 488 GSTO1 antibody CL488-15124Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...