Tested Applications
Positive WB detected in | mouse testis tissue, HeLa cells |
Positive IHC detected in | mouse liver tissue, mouse heart tissue, rat liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
10540-1-AP targets GTF2A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0825 Product name: Recombinant human GTF2A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC001919 Sequence: MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE Predict reactive species |
Full Name | general transcription factor IIA, 2, 12kDa |
Calculated Molecular Weight | 12 kDa |
Observed Molecular Weight | 12 kDa |
GenBank Accession Number | BC001919 |
Gene Symbol | GTF2A2 |
Gene ID (NCBI) | 2958 |
RRID | AB_2114351 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P52657 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Transcription mediated by RNA polymerase II depends on a set of different transcription factors to form the pre-initiation complex. TFIIA is involved in the construction of this complex and increases the affinity of TBP for the DNA union region [PMID:20480367]. TFIIA in a complex with TBP mediates transcriptional activity [PMID: 11030333]. GTF2A2 is one subunit of TFIIA.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for GTF2A2 antibody 10540-1-AP | Download protocol |
IHC protocol for GTF2A2 antibody 10540-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |