Filter: AllWBIHC

WB analysis of mouse testis using 10540-1-AP
mouse testis tissue were subjected to SDS PAGE followed by western blot with 10540-1-AP (GTF2A2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
WB analysis of HeLa using 10540-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 10540-1-AP (GTF2A2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
IHC staining of mouse liver using 10540-1-AP
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 10540-1-AP (GTF2A2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse liver using 10540-1-AP
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 10540-1-AP (GTF2A2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of rat liver using 10540-1-AP
Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 10540-1-AP (GTF2A2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of rat liver using 10540-1-AP
Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 10540-1-AP (GTF2A2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse heart using 10540-1-AP
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 10540-1-AP (GTF2A2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse heart using 10540-1-AP
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 10540-1-AP (GTF2A2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

GTF2A2 Polyclonal antibody

GTF2A2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10540-1-AP

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

TFIIA-12, TFIIA gamma, TFIIA 12, TFIIA, TF2A2

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse testis tissue, HeLa cells
Positive IHC detected in	mouse liver tissue, mouse heart tissue, rat liver tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:200-1:1000
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10540-1-AP targets GTF2A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag0825 Product name: Recombinant human GTF2A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC001919 Sequence: MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE Predict reactive species
Full Name	general transcription factor IIA, 2, 12kDa
Calculated Molecular Weight	12 kDa
Observed Molecular Weight	12 kDa
GenBank Accession Number	BC001919
Gene Symbol	GTF2A2
Gene ID (NCBI)	2958
RRID	AB_2114351
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P52657
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transcription mediated by RNA polymerase II depends on a set of different transcription factors to form the pre-initiation complex. TFIIA is involved in the construction of this complex and increases the affinity of TBP for the DNA union region [PMID:20480367]. TFIIA in a complex with TBP mediates transcriptional activity [PMID: 11030333]. GTF2A2 is one subunit of TFIIA.