• Featured Product
  • KD/KO Validated

GTPBP4 Polyclonal antibody, PBS Only

GTPBP4 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA
Cat No. 13897-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, IP, Indirect ELISA

NGB, GTP-binding protein NGB, GTP-binding protein 4, GTP binding protein NGB, GTP binding protein 4

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

13897-1-PBS targets GTPBP4 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4859

Product name: Recombinant human GTPBP4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 332-634 aa of BC038975

Sequence: KTEACDRLLAHRVETKMKGNKVNEVLNRLHLAIPTRRDDKERPPFIPEGVVARRKRMETEESRKKRERDLELEMGDDYILDLQKYWDLMNLSEKHDKIPEIWEGHNIADYIDPAIMKKLEELEKEEELRTAAGEYDSVSESEDEEMLEIRQLAKQIREKKKLKILESKEKNTQGPRMPRTAKKVQRTVLEKEMRSLGVDMDDKDDAHYAVQARRSRSITRKRKREDSAPPSSVARSGSCSRTPRDVSGLRDVKMVKKAKTMMKNAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR

Predict reactive species
Full Name GTP binding protein 4
Calculated Molecular Weight 634 aa, 74 kDa
Observed Molecular Weight 74 kDa
GenBank Accession NumberBC038975
Gene Symbol GTPBP4
Gene ID (NCBI) 23560
RRIDAB_2279486
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BZE4
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GTP-binding proteins are GTPases and function as molecular switches that can flip between two states: active, when GTP is bound, and inactive, when GDP is bound. 'Active' in this context usually means that the molecule acts as a signal to trigger other events in the cell. When an extracellular ligand binds to a G-protein-linked receptor, the receptor changes its conformation and switches on the trimeric G proteins that associate with it by causing them to eject their GDP and replace it with GTP. The switch is turned off when the G protein hydrolyzes its own bound GTP, converting it back to GDP. But before that occurs, the active protein has an opportunity to diffuse away from the receptor and deliver its message for a prolonged period to its downstream target.

Loading...
||
New chat

Able

正在加载,请稍候...