• Featured Product
  • KD/KO Validated

GTPBP4 Polyclonal antibody

GTPBP4 Polyclonal Antibody for WB, IF/ICC, IP, ELISA
Cat No. 13897-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF/ICC, IP, ELISA

NGB, GTP-binding protein NGB, GTP-binding protein 4, GTP binding protein NGB, GTP binding protein 4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, mouse testis tissue, human kidney tissue, HepG2 cells
Positive IP detected inHeLa cells, mouse testis tissue
Positive IF/ICC detected inMDCK cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13897-1-AP targets GTPBP4 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, goat, drosophila
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4859

Product name: Recombinant human GTPBP4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 332-634 aa of BC038975

Sequence: KTEACDRLLAHRVETKMKGNKVNEVLNRLHLAIPTRRDDKERPPFIPEGVVARRKRMETEESRKKRERDLELEMGDDYILDLQKYWDLMNLSEKHDKIPEIWEGHNIADYIDPAIMKKLEELEKEEELRTAAGEYDSVSESEDEEMLEIRQLAKQIREKKKLKILESKEKNTQGPRMPRTAKKVQRTVLEKEMRSLGVDMDDKDDAHYAVQARRSRSITRKRKREDSAPPSSVARSGSCSRTPRDVSGLRDVKMVKKAKTMMKNAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR

Predict reactive species
Full Name GTP binding protein 4
Calculated Molecular Weight 634 aa, 74 kDa
Observed Molecular Weight 74 kDa
GenBank Accession NumberBC038975
Gene Symbol GTPBP4
Gene ID (NCBI) 23560
RRIDAB_2279486
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BZE4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GTP-binding proteins are GTPases and function as molecular switches that can flip between two states: active, when GTP is bound, and inactive, when GDP is bound. 'Active' in this context usually means that the molecule acts as a signal to trigger other events in the cell. When an extracellular ligand binds to a G-protein-linked receptor, the receptor changes its conformation and switches on the trimeric G proteins that associate with it by causing them to eject their GDP and replace it with GTP. The switch is turned off when the G protein hydrolyzes its own bound GTP, converting it back to GDP. But before that occurs, the active protein has an opportunity to diffuse away from the receptor and deliver its message for a prolonged period to its downstream target.

Protocols

Product Specific Protocols
IF protocol for GTPBP4 antibody 13897-1-APDownload protocol
IP protocol for GTPBP4 antibody 13897-1-APDownload protocol
WB protocol for GTPBP4 antibody 13897-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Genes Dev

Uncoupling of GTP hydrolysis from eIF6 release on the ribosome causes Shwachman-Diamond syndrome.

Authors - Andrew J Finch
DrosophilaWB,IF

Proc Natl Acad Sci U S A

A genome-scale protein interaction profile of Drosophila p53 uncovers additional nodes of the human p53 network.

Authors - Lunardi Andrea A
  • KD Validated
humanWB,IHC

Biochem Biophys Res Commun

Up-regulation of GTPBP4 in colorectal carcinoma is responsible for tumor metastasis.

Authors - Haitao Yu
  • KD Validated
humanWB

Biomed Res Int

Determining the Clinical Value and Critical Pathway of GTPBP4 in Lung Adenocarcinoma Using a Bioinformatics Strategy: A Study Based on Datasets from The Cancer Genome Atlas.

Authors - Zhiqian Zhang
  • KD Validated
humanWB

Nucleic Acids Res

Distinct interactomes of ADAR1 nuclear and cytoplasmic protein isoforms and their responses to interferon induction

Authors - Dragana Vukić
goatIF

Cell Prolif

Decoding the Molecular Landscape of Prepubertal Oocyte Maturation: GTPBP4 as a Key Driver of In Vitro Developmental Competence

Authors - Jianpeng Qin

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

kaosheng (Verified Customer) (11-11-2019)

This antibody detects a very clear and specific band in polysome profiling fractions of human TF1 cells.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: TF1
Loading...
||
New chat Able
正在加载,请稍候...