Use Able AI chat for product recommendations

Granzyme A Polyclonal antibody

Granzyme A Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11288-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, ELISA, Blocking assay

GrA, GZMA, CTL tryptase, CTLA3, Cytotoxic T-lymphocyte proteinase 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse kidney tissue, rat kidney tissue
Positive IHC detected inhuman lymphoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11288-1-AP targets Granzyme A in WB, IHC, IF, ELISA, Blocking assay applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1818

Product name: Recombinant human GZMA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-262 aa of BC015739

Sequence: MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV

Predict reactive species
Full Name granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3)
Calculated Molecular Weight 29 kDa
Observed Molecular Weight 27-30 kDa, 50-60 kDa
GenBank Accession NumberBC015739
Gene Symbol Granzyme A
Gene ID (NCBI) 3001
RRIDAB_2114392
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP12544
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Granzyme A(GrA, a tryptase) is necessary for target cell lysis in cell-mediated immune responses. It activates mitochondrial outer membrane permeabilization- and caspase-independent cell death pathways by cleaving the mitochondrial complex I component NDUFS3after lys56. Among serine proteases GrA has an unique quaternary structure consisting of a disulphide-linked homodimer of 60kDa linked via Cys93.(PMID: 12819769) This protein has 2 isoforms produced by alternative promoter usage with the MW of 29 and 27 kDa.

Protocols

Product Specific Protocols
IHC protocol for Granzyme A antibody 11288-1-APDownload protocol
WB protocol for Granzyme A antibody 11288-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIHC

Int J Biol Sci

Rapamycin and Low-dose IL-2 Mediate an Immunosuppressive Microenvironment to Inhibit Benign Prostatic Hyperplasia

Authors - Tianyu Cao
humanWB

J Proteomics

Proteomic profiling of human decidual immune proteins during Toxoplasma gondii infection.

Authors - Dan Zhang
humanIHC

Immunopharmacol Immunotoxicol

Identification of discrepancy between CTLA4 expression and CTLA4 activation in gastric cancer.

Authors - Zhen Xiang
chickenWB

Res Vet Sci

Characterization of cytotoxicity-related gene expression in response to virulent Marek's disease virus infection in the bursa of Fabricius.

Authors - Cui-Ying Chen
humanIF

Cell Commun Signal

GZMA suppressed GPX4-mediated ferroptosis to improve intestinal mucosal barrier function in inflammatory bowel disease

Authors - Rongwei Niu
mouseWB,IF

CNS Neurosci Ther

Integrated Mendelian Randomization and Single-Cell Transcriptomics Analysis Identifies Critical Blood Biomarkers and Potential Mechanisms in Epilepsy

Authors - Jianwei Shi
Loading...
||
New chat

Able

正在加载,请稍候...