Galectin-3 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Galectin-3 Recombinant monoclonal antibody (84889-3-RR)

• 

  IHC staining of mouse colon using 84889-3-RR

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 84889-3-RR (Galectin-3 antibody) at dilution of 1:20000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse colon using 84889-3-RR

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 84889-3-RR (Galectin-3 antibody) at dilution of 1:20000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 84889-3-RR

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 84889-3-RR (Galectin-3 antibody) at dilution of 1:20000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 84889-3-RR

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 84889-3-RR (Galectin-3 antibody) at dilution of 1:20000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 84889-3-RR

  Biolayer interferometry (BLl) kinetic assays of 84889-3-RR against Mouse Galectin-3 were performed. The affinity constant is 57.2 pM.

Galectin-3 Uni-rAb^® Recombinant Antibody for IHC, ELISA

Cat No. 84889-3-RR

Clone No.242453H8

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

IHC, ELISA

Synonyms

Gal-3, Lgals3, 35 kDa lectin

---

Tested Applications

• Positive IHC detected in: mouse colon tissue, mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:10000-1:40000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84889-3-RR targets Galectin-3 in IHC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1232

  Product name: Recombinant Mouse Galectin-3 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: N-6*His

  Domain: 1-264 aa of

  Sequence: MADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGQPAPGAFPGQPGAPGAYPQCSGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI

• Full Name: lectin, galactose binding, soluble 3
• Calculated Molecular Weight: 28 kDa
• Gene Symbol: Lgals3
• Gene ID (NCBI): 16854
• RRID: AB_3743813
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P16110
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Galectins are a family of animal lectins defined by shared characteristic amino-acid sequences and affinity for β-galactose-containing oligosac-charides (PMID: 8063692). Galectin-3, a member of the β-galactoside-binding proteins, contains one carbohydrate recognition domain (CRD) and a proline- and glycine-rich N-terminal domain through which is able to form oligomers (PMID: 14758078). Galectin-3 is widely expressed in many normal tissues and a variety of tumors. It is found intracellularly in nucleus and cytoplasm or secreted outside of cell, being present on the cell surface or in the extracellular space (PMID: 16478649). Galectin-3 is involved in various biological processes including cell growth, adhesion, differentiation, apoptosis, angiogenesis, immune response, neoplastic transformation and metastasis (PMID: 16478649; 14758078).