Tested Applications
| Positive WB detected in | HEK-293 cells, L02 cells, MG-63 cells, U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21526-1-AP targets Glypican 6 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16135 Product name: Recombinant human GPC6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 213-278 aa of BC106947 Sequence: RAFIAARTFVQGLTVGREVANRVSKVSPTPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCL Predict reactive species |
| Full Name | glypican 6 |
| Calculated Molecular Weight | 555 aa, 63 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC106947 |
| Gene Symbol | GPC6 |
| Gene ID (NCBI) | 10082 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y625 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Glypican-6 (GPC6) is a glycosylphosphatidylinositol-anchored heparan-sulfate proteoglycan that regulates cell-surface signaling cues during development and disease. GPC6 binds Hedgehog ligands and facilitates their interaction with the receptor Patched, thereby amplifying Hh signaling required for long-bone and gastric/intestinal elongation. (PMID: 35235423)
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for Glypican 6 antibody 21526-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

