Tested Applications
| Positive IHC detected in | human brain tissue, mouse brain tissue, rat brain tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 3 publications below |
| IHC | See 3 publications below |
| IF | See 4 publications below |
Product Information
26950-1-AP targets GNRH1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25667 Product name: Recombinant human GNRH1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-92 aa of BC126463 Sequence: QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI Predict reactive species |
| Full Name | gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) |
| Calculated Molecular Weight | 92 aa, 10 kDa |
| GenBank Accession Number | BC126463 |
| Gene Symbol | GNRH1 |
| Gene ID (NCBI) | 2796 |
| RRID | AB_2880698 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01148 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GNRH1 antibody 26950-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Front Endocrinol (Lausanne) The Anti-proliferative Activity of GnRH Through Downregulation of the Akt/ERK Pathways in Pancreatic Cancer.
| ||
Toxins (Basel) The Effects of Zearalenone on the Localization and Expression of Reproductive Hormones in the Ovaries of Weaned Gilts. | ||
bioRxiv Expression of the ACE2 virus entry protein in the nervus terminalis reveals the potential for an alternative route to brain infection in COVID-19. | ||
JCI Insight Investigation of a mouse model of Prader-Willi syndrome with combined disruption of Necdin and Magel2 | ||
Nat Neurosci A GnRH neuronal population in the olfactory bulb translates socially relevant odors into reproductive behavior in male mice | ||
Cell Metab Preventing and correcting polycystic ovary syndrome by targeting anti-Müllerian hormone signaling in minipuberty and adulthood in mice |















