Tested Applications
Positive IHC detected in | human brain tissue, mouse brain tissue, rat brain tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 2 publications below |
IHC | See 2 publications below |
IF | See 3 publications below |
Product Information
26950-1-AP targets GNRH1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, pig |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25667 Product name: Recombinant human GNRH1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-92 aa of BC126463 Sequence: QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI Predict reactive species |
Full Name | gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) |
Calculated Molecular Weight | 92 aa, 10 kDa |
GenBank Accession Number | BC126463 |
Gene Symbol | GNRH1 |
Gene ID (NCBI) | 2796 |
RRID | AB_2880698 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P01148 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for GNRH1 antibody 26950-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Front Endocrinol (Lausanne) The Anti-proliferative Activity of GnRH Through Downregulation of the Akt/ERK Pathways in Pancreatic Cancer.
| ||
Toxins (Basel) The Effects of Zearalenone on the Localization and Expression of Reproductive Hormones in the Ovaries of Weaned Gilts. | ||
bioRxiv Expression of the ACE2 virus entry protein in the nervus terminalis reveals the potential for an alternative route to brain infection in COVID-19. | ||
Nat Neurosci A GnRH neuronal population in the olfactory bulb translates socially relevant odors into reproductive behavior in male mice | ||
JCI Insight Investigation of a mouse model of Prader-Willi syndrome with combined disruption of Necdin and Magel2 | ||
Cell Metab Preventing and correcting polycystic ovary syndrome by targeting anti-Müllerian hormone signaling in minipuberty and adulthood in mice |