GNRH1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GNRH1 Polyclonal antibody (26950-1-AP)

• Featured Product
• KD/KO Validated

GNRH1 Polyclonal Antibody for IHC, ELISA

Cat No. 26950-1-AP Copied!

Publications (14)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

GNRH, GnRH-associated peptide 1, Gonadoliberin-1, Progonadoliberin-1

• 

  IHC staining of human brain using 26950-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 26950-1-AP (GnRH antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 26950-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 26950-1-AP (GnRH antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 26950-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26950-1-AP (GNRH1 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 26950-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26950-1-AP (GNRH1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 26950-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 26950-1-AP (GNRH1 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 26950-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 26950-1-AP (GNRH1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 26950-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 26950-1-AP (GnRH antibody) at dilution of 1:400 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 26950-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 26950-1-AP (GnRH antibody) at dilution of 1:400 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GNRH1 in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: human brain tissue, mouse brain tissue, rat brain tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26950-1-AP targets GNRH1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25667

  Product name: Recombinant human GNRH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-92 aa of BC126463

  Sequence: QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI

• Full Name: gonadotropin-releasing hormone 1 (luteinizing-releasing hormone)
• Calculated Molecular Weight: 92 aa, 10 kDa
• GenBank Accession Number: BC126463
• Gene Symbol: GNRH1
• Gene ID (NCBI): 2796
• RRID: AB_2880698
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01148
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The GNRH1 Polyclonal antibody (Cat# 26950-1-AP) has 14 citations published in journals including Science, Cell Metabolism, Nature Neuroscience, NPJ Biofilms and Microbiomes, EBioMedicine, JCI Insight, Frontiers in Endocrinology, International Journal of Molecular Sciences, Cell Signaling, Poultry Science, Toxins, Veterinary Journal, and bioRxiv. Research fields span reproductive endocrinology (GnRH signaling, hypothalamic-pituitary-gonadal axis), neuroscience, pancreatic cancer, toxicology, veterinary immunocastration, and neuroanatomy.

Automatically generated from the 14 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Science; Microglia Rank signaling regulates GnRH neuronal function and the hypothalamic-pituitary-gonadal axis.; Authors - Alejandro Collado-Sole
		Cell Metab; Preventing and correcting polycystic ovary syndrome by targeting anti-Müllerian hormone signaling in minipuberty and adulthood in mice; Authors - Ludovica Cotellessa
mouse,human	IHC,IF	Nat Neurosci; A GnRH neuronal population in the olfactory bulb translates socially relevant odors into reproductive behavior in male mice; Authors - Laurine Decoster
mouse	IHC,IF	NPJ Biofilms Microbiomes; Di (2-ethylhexyl) Phthalate decrease pregnancy rate via disrupting the microbe-gut-hypothalamic-pituitary-ovarian axis in mice; Authors - Linjie Xu
		EBioMedicine; Establishing the role of ZBTB20 mutations in GnRH deficiency and impaired neurogenesis in the subventricular zone: a human cohort and animal model study.; Authors - Jun Guan
mouse	IF	JCI Insight; Investigation of a mouse model of Prader-Willi syndrome with combined disruption of Necdin and Magel2; Authors - Pierre-Yves Barelle