GNRH1 Polyclonal antibody

• 

  IHC staining of human brain using 26950-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 26950-1-AP (GnRH antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 26950-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 26950-1-AP (GnRH antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 26950-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26950-1-AP (GNRH1 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 26950-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26950-1-AP (GNRH1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 26950-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 26950-1-AP (GNRH1 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 26950-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 26950-1-AP (GNRH1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human testis using 26950-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 26950-1-AP (GnRH antibody) at dilution of 1:400 (under 10x lens).

• 

  IHC staining of human testis using 26950-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 26950-1-AP (GnRH antibody) at dilution of 1:400 (under 40x lens).

• Featured Product
• KD/KO Validated

GNRH1 Polyclonal Antibody for IHC, ELISA

Cat No. 26950-1-AP

Publications(8)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

GNRH, GnRH-associated peptide 1, Gonadoliberin-1, Progonadoliberin-1

---

Tested Applications

• Positive IHC detected in: human brain tissue, mouse brain tissue, rat brain tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 3 publications below
• IF: See 4 publications below

Product Information

26950-1-AP targets GNRH1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25667

  Product name: Recombinant human GNRH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-92 aa of BC126463

  Sequence: QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI

• Full Name: gonadotropin-releasing hormone 1 (luteinizing-releasing hormone)
• Calculated Molecular Weight: 92 aa, 10 kDa
• GenBank Accession Number: BC126463
• Gene Symbol: GNRH1
• Gene ID (NCBI): 2796
• RRID: AB_2880698
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01148
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Endocrinol (Lausanne); The Anti-proliferative Activity of GnRH Through Downregulation of the Akt/ERK Pathways in Pancreatic Cancer.; Authors - Linna Suo ; KD Validated
pig	WB,IHC	Toxins (Basel); The Effects of Zearalenone on the Localization and Expression of Reproductive Hormones in the Ovaries of Weaned Gilts.; Authors - Boyang Wan
mouse	IF	bioRxiv; Expression of the ACE2 virus entry protein in the nervus terminalis reveals the potential for an alternative route to brain infection in COVID-19.; Authors - Katarzyna Bilinska
mouse,human	IHC,IF	Nat Neurosci; A GnRH neuronal population in the olfactory bulb translates socially relevant odors into reproductive behavior in male mice; Authors - Laurine Decoster
		Cell Metab; Preventing and correcting polycystic ovary syndrome by targeting anti-Müllerian hormone signaling in minipuberty and adulthood in mice; Authors - Ludovica Cotellessa
rat	WB	Cell Signal; Overexpression of Rap1B alleviate central precocious puberty and neurodevelopmental damage; Authors - Xiaodong Liu