Granzyme K Monoclonal antibody, PBS Only

• 

  IHC staining of human tonsillitis using 67272-1-Ig (same clone as 67272-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67272-1-Ig (GZMK antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67272-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 67272-1-Ig (same clone as 67272-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67272-1-Ig (GZMK antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67272-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 67272-1-Ig (same clone as 67272-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67272-1-Ig (GZMK antibody) at dilution of 1:1000 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67272-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 67272-1-Ig (same clone as 67272-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67272-1-Ig (Granzyme K antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67272-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human tonsillitis using 67272-1-Ig (same clone as 67272-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using Granzyme K antibody (67272-1-Ig, Clone: 1C3A4 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). DAPI (blue). This data was developed using the same antibody clone with 67272-1-PBS in a different storage buffer formulation.

Granzyme K Monoclonal Antibody for IHC, IF-P, ELISA

Cat No. 67272-1-PBS

Clone No.1C3A4

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

IHC, IF-P, ELISA

Synonyms

GZMK, Granzyme3, Granzyme 3, Fragmentin-3, Fragmentin 3

---

Product Information

67272-1-PBS targets Granzyme K in IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27297

  Product name: Recombinant human GZMK protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 85-215 aa of BC035802

  Sequence: HSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSG

• Full Name: granzyme K (granzyme 3; NK tryptase II)
• Calculated Molecular Weight: 29 kDa
• GenBank Accession Number: BC035802
• Gene Symbol: GZMK
• Gene ID (NCBI): 3003
• RRID: AB_2882541
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P49863
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Granzymes are a family of serine proteases stored in granules inside cytotoxic cells of the immune system. There are five human granzymes (granzyme A (GrA), GrB, GrH, GrK and GrM) currently identified, whereas mice have ten known granzymes (GrA-G, GrK, GrM and GrN) (PMID:14499263). Human GrK was first discovered in 1988 after purification from human peripheral blood mononuclear cells. GrK is expressed by cytotoxic T lymphocytes, natural killer T cells (NKT), γδ T cells and CD56bright+ NK cells.