Histone H2A.X Polyclonal antibody

Histone H2A.X Polyclonal Antibody for WB, IHC, IF/ICC, ChIP, ELISA

Cat No. 10856-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, CoIP, ChIP, ELISA

H2A, H2AFX, H2A histone family, member X, H2A.X, H2AX

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HL-60 cells, HEK-293 ells, mouse heart, mouse kidney, rat kidney
Positive IHC detected inhuman lymphoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells, U-251 cells, U2OS cells
Positive ChIP detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:1000-1:4000
Chromatin immunoprecipitation (ChIP)CHIP : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10856-1-AP targets Histone H2A.X in WB, IHC, IF/ICC, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1305

Product name: Recombinant human Histone H2A.X protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-143 aa of BC013416

Sequence: MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY

Predict reactive species
Full Name H2A histone family, member X
Calculated Molecular Weight 15 kDa
Observed Molecular Weight 15-18 kDa
GenBank Accession NumberBC013416
Gene Symbol Histone H2A.X
Gene ID (NCBI) 3014
RRIDAB_2114985
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP16104
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Histone H2A.X belongs to the histone H2A family, which is synthesized in G1 and S phase. It is involved in nucleosomal organization of chromatin together with other histone proteins, and is specially important for recombination between immunoglobulin switch regions. H2A.X becomes phosphorylated on serine 139 (to form gamma-H2AFX or H2AX139ph) in response to DNA double strand breaks (DSBs) generated by exogenous genotoxic agents and by stalled replication forks, which promotes DNA repair and maintains genomic stability. The calculated molecular weight of H2AX is 15 kDa, but the ubiquitinated H2A.X is about 22 kDa.

Protocols

Product Specific Protocols
IF protocol for Histone H2A.X antibody 10856-1-APDownload protocol
IHC protocol for Histone H2A.X antibody 10856-1-APDownload protocol
WB protocol for Histone H2A.X antibody 10856-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,humanWB

Nat Aging

Single-cell and spatial RNA sequencing identify divergent microenvironments and progression signatures in early- versus late-onset prostate cancer

Authors - Yifei Cheng

Acta Pharm Sin B

Design, synthesis, and antitumor activity of novel thioheterocyclic nucleoside derivatives by suppressing the c-MYC pathway

Authors - Xian-Jia Li
humanWB,IHC,IF

ACS Nano

Polyoxometalate-Based Radiosensitization Platform for Treating Hypoxic Tumors by Attenuating Radioresistance and Enhancing Radiation Response.

Authors - Yuan Yong
mouseIF

ACS Nano

A Heterojunction Structured WO2.9-WSe2 Nanoradiosensitizer Increases Local Tumor Ablation and Checkpoint Blockade Immunotherapy upon Low Radiation Dose.

Authors - Xinghua Dong
mouseWB

Nat Commun

Telomere dysfunction activates YAP1 to drive tissue inflammation.

Authors - Deepavali Chakravarti
humanWB

Nucleic Acids Res

KDM6B promotes PARthanatos via suppression of O6-methylguanine DNA methyltransferase repair and sustained checkpoint response.

Authors - Mingming Yang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Kamal (Verified Customer) (02-27-2025)

Mouse liver lysates were subjected to SDS-PAGE and immunoblotted with Histone H2A.X Polyclonal antibody (1:2000 in 1XTBST). Bands appeared at 15 kDa.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Mouse Liver tissue
Histone H2A.X Antibody Western Blot validation (1:2000 dilution) in Mouse Liver tissue (Cat no:10856-1-AP)
FH

Andreas (Verified Customer) (03-23-2022)

Antibody gives very good signal, hence the dilution factor. One important note is that I include 1:2000 dilution of benzonase in my lysis buffer to recover most of the chromatin-bound material, which big part of it is otherwise lost during the clarification step.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: HEK293FT
FH

kes (Verified Customer) (01-17-2022)

used for WB (1:1000) in milk+TBST buffer and got good results

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: LIver cell lines
Loading...
||
New chat

Able

正在加载,请稍候...