Tested Applications
| Positive WB detected in | A549 cells, Caco-2 cells, mouse brain tissue, HeLa cells, rat brain |
| Positive IHC detected in | human intrahepatic cholangiocarcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IF | See 1 publications below |
| IP | See 1 publications below |
Product Information
26875-1-AP targets H2AFY in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25445 Product name: Recombinant human H2AFY protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 123-235 aa of BC013331 Sequence: KLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEK Predict reactive species |
| Full Name | H2A histone family, member Y |
| Calculated Molecular Weight | 372 aa, 40 kDa |
| Observed Molecular Weight | 40 kDa |
| GenBank Accession Number | BC013331 |
| Gene Symbol | H2AFY |
| Gene ID (NCBI) | 9555 |
| RRID | AB_2918113 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75367 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for H2AFY antibody 26875-1-AP | Download protocol |
| IHC protocol for H2AFY antibody 26875-1-AP | Download protocol |
| WB protocol for H2AFY antibody 26875-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |













