Product Information
88145-3-PBS targets HA2U as part of a matched antibody pair:
MP03392-1: 88145-4-PBS capture and 88145-3-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg9227 Product name: Recombinant mouse HA2U protein Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 85-177 aa of / Sequence: PQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVADGVYETSFFVNRDYSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLKHWE Predict reactive species |
| Full Name | histocompatibility 2, class II antigen A, alpha |
| Calculated Molecular Weight | 25 kDa |
| GenBank Accession Number | / |
| Gene Symbol | MHC Class II |
| Gene ID (NCBI) | 14960 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P14438 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



