Tested Applications
Positive WB detected in | pig brain tissue, rat brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
27818-1-AP targets HAPLN2 in WB, ELISA applications and shows reactivity with Human, Rat, Pig samples.
Tested Reactivity | Human, Rat, Pig |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag27169 Product name: Recombinant human HAPLN2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-120 aa of BC029864 Sequence: MPGWLTLPTLCRFLLWAFTIFHKAQGDPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLHARGYGPLGGRARMRRGHRLDASLVIAGVRL Predict reactive species |
Full Name | hyaluronan and proteoglycan link protein 2 |
Calculated Molecular Weight | 38 kDa |
Observed Molecular Weight | 35 kDa |
GenBank Accession Number | BC029864 |
Gene Symbol | HAPLN2 |
Gene ID (NCBI) | 60484 |
RRID | AB_2880982 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9GZV7 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for HAPLN2 antibody 27818-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |