Filter:
Tested Applications
| Positive WB detected in | pig brain tissue, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27818-1-AP targets HAPLN2 in WB, ELISA applications and shows reactivity with Human, Rat, Pig samples.
| Tested Reactivity | Human, Rat, Pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27169 Product name: Recombinant human HAPLN2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-120 aa of BC029864 Sequence: MPGWLTLPTLCRFLLWAFTIFHKAQGDPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLHARGYGPLGGRARMRRGHRLDASLVIAGVRL Predict reactive species |
| Full Name | hyaluronan and proteoglycan link protein 2 |
| Calculated Molecular Weight | 38 kDa |
| Observed Molecular Weight | 35 kDa |
| GenBank Accession Number | BC029864 |
| Gene Symbol | HAPLN2 |
| Gene ID (NCBI) | 60484 |
| RRID | AB_2880982 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9GZV7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for HAPLN2 antibody 27818-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
