Tested Applications
Positive WB detected in | K-562 cells, human placenta tissue |
Positive IP detected in | K-562 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:16000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IF | See 1 publications below |
Product Information
25728-1-AP targets HBG1 in WB, IF, IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22776 Product name: Recombinant human HBG1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC010913 Sequence: MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDATKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIH Predict reactive species |
Full Name | hemoglobin, gamma A |
Calculated Molecular Weight | 147 aa, 16 kDa |
Observed Molecular Weight | 14-16 kDa |
GenBank Accession Number | BC010913 |
Gene Symbol | HBG1 |
Gene ID (NCBI) | 3047 |
RRID | AB_2880212 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P69891 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for HBG1 antibody 25728-1-AP | Download protocol |
IP protocol for HBG1 antibody 25728-1-AP | Download protocol |
FC protocol for HBG1 antibody 25728-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Front Pharmacol Beneficial Effect of Edoxaban on Preventing Atrial Fibrillation and Coagulation by Reducing Inflammation via HBG1/HBD Biomarkers. |