Tested Applications
| Positive WB detected in | K-562 cells, human placenta tissue |
| Positive IP detected in | K-562 cells |
| Positive IF/ICC detected in | K-562 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25728-1-AP targets HBG1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22776 Product name: Recombinant human HBG1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC010913 Sequence: MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDATKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIH Predict reactive species |
| Full Name | hemoglobin, gamma A |
| Calculated Molecular Weight | 147 aa, 16 kDa |
| Observed Molecular Weight | 14-16 kDa |
| GenBank Accession Number | BC010913 |
| Gene Symbol | HBG1 |
| Gene ID (NCBI) | 3047 |
| RRID | AB_2880212 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P69891 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HBG1 (Hemoglobin Subunit Gamma-1) is a human gene that encodes the Aγ-globin chain, a key component of fetal hemoglobin (HbF). It is primarily expressed in the fetal liver and spleen, combining with Aγ-globin to produce HbF. HBG1 is crucial for oxygen transport before birth and is targeted by CRISPR-Cas9 therapies to re-induce high HbF levels to treat sickle cell disease.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for HBG1 antibody 25728-1-AP | Download protocol |
| IP protocol for HBG1 antibody 25728-1-AP | Download protocol |
| WB protocol for HBG1 antibody 25728-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Front Pharmacol Beneficial Effect of Edoxaban on Preventing Atrial Fibrillation and Coagulation by Reducing Inflammation via HBG1/HBD Biomarkers. | ||
bioRxiv TIAR-dependent coordination of alternative splicing and lipid peroxidation is required for CML cell resistance to imatinib in the bone marrow stroma. | ||
bioRxiv The NanoBridge system for targeted post-translational modification of challenging proteins. | ||
bioRxiv Transcriptional readthrough precedes alternative splicing programs triggered in CML cells by imatinib. |





