HBP1 Polyclonal antibody, PBS Only

• 

  WB analysis of human brain using 11746-1-AP (same clone as 11746-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 11746-1-AP (HBP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11746-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 11746-1-AP (same clone as 11746-1-PBS)

  SGC-7901 cells were subjected to SDS PAGE followed by western blot with 11746-1-AP (HBP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11746-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 11746-1-AP (same clone as 11746-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 11746-1-AP (HBP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11746-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 11746-1-AP (same clone as 11746-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 11746-1-AP (HBP1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11746-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 11746-1-AP (same clone as 11746-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 11746-1-AP (HBP1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11746-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 11746-1-AP (same clone as 11746-1-PBS)

  IP result of anti-HBP1 (IP:11746-1-AP, 4ug; Detection:11746-1-AP 1:500) with mouse brain tissue lysate 4000ug. This data was developed using the same antibody clone with 11746-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

HBP1 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 11746-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

11746-1-PBS targets HBP1 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2342

  Product name: Recombinant human HBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 215-514 aa of BC022329

  Sequence: FLKGTRLCFHKGSNKEWQDVEDFARAEGCDNEEDLQMGIHKGYGSDGLKLLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGIPCCEVHIGDVCLPPGHPDAINFDDPGVFDTFKSYDFTPMDSSAVYVLSSMARQRRASLSCGGPGGQDFARSGFSKNCGSPGSSQLSSNSLYAKAVKNHSSGTVSATSPNKCKRPMNAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEERRMYTLEAKALAEEQKRLNPDCWKRKRTNSGSQQH

• Full Name: HMG-box transcription factor 1
• Calculated Molecular Weight: 514 aa, 58 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC022329
• Gene Symbol: HBP1
• Gene ID (NCBI): 26959
• RRID: AB_2247970
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60381
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HMG-box protein 1 (HBP1) is a transcriptional repressor, and has a role in cell cycle progression and tumor suppression. Also it's a repressor of the cyclin D1 gene and inhibits the Wnt signaling pathway. Interaction with RB1 enhances it's binding to the H1F0 promoter . Disrupts the interaction between DNA and TCF4. This is a rabbit polyclonal antibody raised against part of C-terminus of HBP1 of human origin.