HBP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HBP1 Polyclonal antibody (11746-1-AP)

• Featured Product
• KD/KO Validated

HBP1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 11746-1-AP Copied!

Publications (18)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, IP, ChIP, ELISA

Synonyms

HMG box containing protein 1, HMG box transcription factor 1, HMG box-containing protein 1

• 

  WB analysis of human brain using 11746-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 11746-1-AP (HBP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 11746-1-AP

  SGC-7901 cells were subjected to SDS PAGE followed by western blot with 11746-1-AP (HBP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 11746-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 11746-1-AP (HBP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 11746-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 11746-1-AP (HBP1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 11746-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 11746-1-AP (HBP1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 11746-1-AP

  IP result of anti-HBP1 (IP:11746-1-AP, 4ug; Detection:11746-1-AP 1:500) with mouse brain tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HBP1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human brain tissue, SGC-7901 cells
• Positive IP detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11746-1-AP targets HBP1 in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2342

  Product name: Recombinant human HBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 215-514 aa of BC022329

  Sequence: FLKGTRLCFHKGSNKEWQDVEDFARAEGCDNEEDLQMGIHKGYGSDGLKLLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGIPCCEVHIGDVCLPPGHPDAINFDDPGVFDTFKSYDFTPMDSSAVYVLSSMARQRRASLSCGGPGGQDFARSGFSKNCGSPGSSQLSSNSLYAKAVKNHSSGTVSATSPNKCKRPMNAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEERRMYTLEAKALAEEQKRLNPDCWKRKRTNSGSQQH

• Full Name: HMG-box transcription factor 1
• Calculated Molecular Weight: 514 aa, 58 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC022329
• Gene Symbol: HBP1
• Gene ID (NCBI): 26959
• RRID: AB_2247970
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60381
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HMG-box protein 1 (HBP1) is a transcriptional repressor, and has a role in cell cycle progression and tumor suppression. Also it's a repressor of the cyclin D1 gene and inhibits the Wnt signaling pathway. Interaction with RB1 enhances it's binding to the H1F0 promoter . Disrupts the interaction between DNA and TCF4. This is a rabbit polyclonal antibody raised against part of C-terminus of HBP1 of human origin.

Publications

What published studies show

The HBP1 antibody (Cat# 11746-1-AP) has 18 citations spanning journals including Cancer Cell, Molecular Cell, Oncogene, PLoS Biology, EMBO Reports, Journal of Biological Chemistry, Pharmacological Research, Scientific Reports, and Aging. Research fields cover cancer biology (breast, lung, liver, leukemia), cell senescence, ferroptosis, protein degradation pathways, epigenetics, diabetes, stem cell differentiation, cardiac hypertrophy, and reproductive biology. Applications are predominantly WB, with IHC, IF, and ChIP also represented.

Automatically generated from the 18 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Cell; MYC through miR-17-92 suppresses specific target genes to maintain survival, autonomous proliferation, and a neoplastic state.; Authors - Yulin Li
human	WB	Mol Cell; mTORC1-CTLH E3 ligase regulates the degradation of HMG-CoA synthase 1 through the Pro/N-degron pathway; Authors - Sang Ah Yi
human	WB	J Exp Clin Cancer Res; HBP1-mediated transcriptional repression of AFP inhibits hepatoma progression.; Authors - Zhengyi Cao
mouse,human	WB,IHC	Pharmacol Res; Targeting of HBP1/TIMP3 axis as a novel strategy against breast cancer; Authors - Yue Zhou
mouse,human	WB,IHC	Oncogene; miR-29c&b2 encourage extramedullary infiltration resulting in the poor prognosis of acute myeloid leukemia.; Authors - Yanyu Wei ; KD Validated
human	WB,IHC	Oncogene; CRISPR interference and activation of the microRNA-3662-HBP1 axis control progression of triple-negative breast cancer.; Authors - Baozhu Yi

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

The single review for this product is a 5-star rating from a Western Blot application. The reviewer reported that the antibody produced a strong, single-band signal, indicating clear and specific detection. Overall, the feedback is positive, highlighting the antibody's performance in generating a clean, well-defined result.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

S (Verified Customer) (11-22-2021)

This antibody gave a strong one band signal.

• Applications: Western Blot