• Featured Product
  • KD/KO Validated

HBXIP Polyclonal antibody

HBXIP Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA
Cat No. 14492-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, FC (Intra), IP, ELISA

HBV X interacting protein, HBV X-interacting protein, HBX interacting protein, HBX-interacting protein, Hepatitis B virus X-interacting protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inK-562 cells, U2OS cells
Positive IP detected inK-562 cells
Positive IHC detected inhuman hepatocellular cancer
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14492-1-AP targets HBXIP in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5894

Product name: Recombinant human HBXIP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-173 aa of BC062619

Sequence: MEPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLRSTPRSRQVTEACGGEGRAVPLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS

Predict reactive species
Full Name hepatitis B virus x interacting protein
Calculated Molecular Weight 10 kDa
Observed Molecular Weight 12 kDa
GenBank Accession NumberBC062619
Gene Symbol HBXIP
Gene ID (NCBI) 10542
RRIDAB_2878062
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDA0A8Z5A536
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HBXIP, also named as XIP, belongs to the HBXIP family. It is originally identified by its interaction with the C-terminus of hepatitis B virus (HBV) X protein (HBx). HBXIP is a regulator of centrosome dynamics and cytokinesis. HBXIP is able to up-regulate S100A4 though activating STAT4 and inducing DNA methylation of PTEN. HBXIP has multiple isoforms with molecular weights of 8-10 kd and 18 kd. This antibody mainly recognizes the 10 kd isoform.

Protocols

Product Specific Protocols
FC protocol for HBXIP antibody 14492-1-APDownload protocol
IHC protocol for HBXIP antibody 14492-1-APDownload protocol
IP protocol for HBXIP antibody 14492-1-APDownload protocol
WB protocol for HBXIP antibody 14492-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Autophagy

KAT7-mediated CANX (calnexin) crotonylation regulates leucine-stimulated MTORC1 activity.

Authors - Guokai Yan
humanWB

Front Oncol

Germacrone Regulates HBXIP-Mediated Cell Cycle, Apoptosis and Promotes the Formation of Autophagosomes to Inhibit the Proliferation of Gastric Cancer Cells.

Authors - Xing Fang
humanWB,IP,IHC

J Biol Chem

The oncoprotein HBXIP uses two pathways to up-regulate S100A4 in promotion of growth and migration of breast cancer cells.

Authors - Liu Shuangping S
humanWB,IHC

Cancer Lett

The oncoprotein HBXIP up-regulates Skp2 via activating transcription factor E2F1 to promote proliferation of breast cancer cells.

Authors - Xu Fuqiang F
  • KD Validated
humanWB,IHC

Int J Oncol

The oncoprotein hepatitis B X-interacting protein promotes the migration of ovarian cancer cells through the upregulation of S-phase kinase-associated protein 2 by Sp1.

Authors - Fuqiang Xu
  • KD Validated
humanWB,IHC

Am J Cancer Res

Elevated HBXIP expression is associated with aggressive phenotype and poor prognosis in esophageal squamous cell carcinoma.

Authors - Honggang Xia
Loading...
||
New chat

Able

正在加载,请稍候...