Tested Applications
| Positive WB detected in | K-562 cells, U2OS cells |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | human hepatocellular cancer Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14492-1-AP targets HBXIP in WB, IHC, IF/ICC, FC (Intra), IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5894 Product name: Recombinant human HBXIP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-173 aa of BC062619 Sequence: MEPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLRSTPRSRQVTEACGGEGRAVPLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS Predict reactive species |
| Full Name | hepatitis B virus x interacting protein |
| Calculated Molecular Weight | 10 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC062619 |
| Gene Symbol | HBXIP |
| Gene ID (NCBI) | 10542 |
| RRID | AB_2878062 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | A0A8Z5A536 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HBXIP, also named as XIP, belongs to the HBXIP family. It is originally identified by its interaction with the C-terminus of hepatitis B virus (HBV) X protein (HBx). HBXIP is a regulator of centrosome dynamics and cytokinesis. HBXIP is able to up-regulate S100A4 though activating STAT4 and inducing DNA methylation of PTEN. HBXIP has multiple isoforms with molecular weights of 8-10 kd and 18 kd. This antibody mainly recognizes the 10 kd isoform.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for HBXIP antibody 14492-1-AP | Download protocol |
| IHC protocol for HBXIP antibody 14492-1-AP | Download protocol |
| IP protocol for HBXIP antibody 14492-1-AP | Download protocol |
| WB protocol for HBXIP antibody 14492-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-HBXIP antibody (Cat# 14492-1-AP) has 14 citations published in journals including Autophagy, EMBO Journal, Journal of Biological Chemistry, Cancer Letters, Life Sciences, International Journal of Oncology, Journal of Ovarian Research, Molecules, Pathology Research & Practice, Tumor Biology, Frontiers in Oncology, American Journal of Cancer Research, and Phytomedicine. Research fields span cancer biology (breast, ovarian, colorectal, pancreatic, lung, gastric, esophageal cancers, HCC, glioblastoma), autophagy, cell proliferation, migration, EMT, and prognostic biomarkers.
| Species | Application | Title |
|---|---|---|
Autophagy KAT7-mediated CANX (calnexin) crotonylation regulates leucine-stimulated MTORC1 activity. | ||
Cancer Lett The oncoprotein HBXIP up-regulates Skp2 via activating transcription factor E2F1 to promote proliferation of breast cancer cells.
| ||
Phytomedicine Nepetin suppresses HBV-associated hepatocellular carcinoma metastasis by regulating the HBx/HIF-1α-mediated autophagy axis. | ||
EMBO J Micropeptide hSPAR regulates glutamine levels and suppresses mammary tumor growth via a TRIM21-P27KIP1-mTOR axis | ||
Int J Oncol The oncoprotein hepatitis B X-interacting protein promotes the migration of ovarian cancer cells through the upregulation of S-phase kinase-associated protein 2 by Sp1.
| ||
Life Sci HBXIP: a potential prognosis biomarker of colorectal cancer which promotes invasion and migration via epithelial-mesenchymal transition.
|
