HBXIP Polyclonal antibody

• 

  WB analysis using 14492-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14492-1-AP (HBXIP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of K-562 using 14492-1-AP

  IP result of anti-HBXIP (IP:14492-1-AP, 4ug; Detection:14492-1-AP 1:300) with K-562 cells lysate 1600 ug.

• 

  IHC staining of human breast cancer using 14492-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 14492-1-AP (HBXIP Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human breast cancer using 14492-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 14492-1-AP (HBXIP Antibody) at dilution of 1:200 (under 40x lens).

• 

  FC experiment of MCF-7 using 14492-1-AP

  1x10^6 MCF-7 cells were intracellularly stained with 0.8 ug HBXIP Polyclonal antibody (14492-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.8 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

HBXIP Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA

Cat No. 14492-1-AP

Publications(12)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, FC (Intra), IP, ELISA

Synonyms

HBV X interacting protein, HBV X-interacting protein, HBX interacting protein, HBX-interacting protein, Hepatitis B virus X-interacting protein

---

Tested Applications

• Positive WB detected in: K-562 cells, U2OS cells
• Positive IP detected in: K-562 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 10 publications below
• IHC: See 8 publications below
• IF: See 2 publications below
• IP: See 1 publications below

Product Information

14492-1-AP targets HBXIP in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5894

  Product name: Recombinant human HBXIP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-173 aa of BC062619

  Sequence: MEPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLRSTPRSRQVTEACGGEGRAVPLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS

• Full Name: hepatitis B virus x interacting protein
• Calculated Molecular Weight: 10 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC062619
• Gene Symbol: HBXIP
• Gene ID (NCBI): 10542
• RRID: AB_2878062
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A0A8Z5A536
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HBXIP, also named as XIP, belongs to the HBXIP family. It is originally identified by its interaction with the C-terminus of hepatitis B virus (HBV) X protein (HBx). HBXIP is a regulator of centrosome dynamics and cytokinesis. HBXIP is able to up-regulate S100A4 though activating STAT4 and inducing DNA methylation of PTEN. HBXIP has multiple isoforms with molecular weights of 8-10 kd and 18 kd. This antibody mainly recognizes the 10 kd isoform.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Autophagy; KAT7-mediated CANX (calnexin) crotonylation regulates leucine-stimulated MTORC1 activity.; Authors - Guokai Yan
human	WB	Front Oncol; Germacrone Regulates HBXIP-Mediated Cell Cycle, Apoptosis and Promotes the Formation of Autophagosomes to Inhibit the Proliferation of Gastric Cancer Cells.; Authors - Xing Fang
human	WB,IP,IHC	J Biol Chem; The oncoprotein HBXIP uses two pathways to up-regulate S100A4 in promotion of growth and migration of breast cancer cells.; Authors - Liu Shuangping S
human	WB,IHC	Cancer Lett; The oncoprotein HBXIP up-regulates Skp2 via activating transcription factor E2F1 to promote proliferation of breast cancer cells.; Authors - Xu Fuqiang F ; KD Validated
human	WB,IHC	Int J Oncol; The oncoprotein hepatitis B X-interacting protein promotes the migration of ovarian cancer cells through the upregulation of S-phase kinase-associated protein 2 by Sp1.; Authors - Fuqiang Xu ; KD Validated
human	WB,IHC	Am J Cancer Res; Elevated HBXIP expression is associated with aggressive phenotype and poor prognosis in esophageal squamous cell carcinoma.; Authors - Honggang Xia