Tested Applications
Positive WB detected in | HeLa cells, A431 cells, HAP1 cells, HL-60 cells, U-251 cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, bEnd.3 cells, NIH/3T3 cells, C6 cells, mouse testis tissue, rat testis tissue |
Positive IP detected in | A431 cells |
Positive IHC detected in | human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | K-562 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:8000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 9 publications below |
WB | See 57 publications below |
IHC | See 9 publications below |
IF | See 7 publications below |
IP | See 4 publications below |
CoIP | See 3 publications below |
ChIP | See 2 publications below |
Product Information
10255-1-AP targets HDAC3 in WB, IHC, IF/ICC, IP, CoIP, chIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0396 Product name: Recombinant human HDAC3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 187-395 aa of BC000614 Sequence: VMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADA Predict reactive species |
Full Name | histone deacetylase 3 |
Calculated Molecular Weight | 49 kDa |
Observed Molecular Weight | 49 kDa |
GenBank Accession Number | BC000614 |
Gene Symbol | HDAC3 |
Gene ID (NCBI) | 8841 |
RRID | AB_2279733 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O15379 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
What is the molecular weight of HDAC3? Is HDAC3 post-translationally modified?
The molecular weight of HDAC3 is 49 kDa but HDAC3 can form homodimers and homotrimers in cells (PMID: 11779848). HDAC3 can be phosphorylated at S424 residue by protein kinase CK2, which regulates HDAC3 activity (PMID: 15805470).
What is the subcellular localization of HDAC3?
Unlike other class I HDACs, HDAC3 actively shuttles between the nucleus and cytoplasm (PMID: 11779848). Additionally, HDAC3 can be present at the plasma membrane, where it associates with c-Src (PMID: 16532030).
What is the tissue expression pattern of HDAC3?
Like other class I HDACs, HDAC3 is ubiquitously expressed (PMID: 9346952).
What is the mechanism of HDAC3 in regulating gene expression?
Unlike other histone deacetylates, it exists in a complex with two proteins - nuclear receptor co-repressor (N-CoR) and silencing mediator for retinoid and thyroid receptors (SMRT) - and therefore acts as a mediator of the repression function of unliganded nuclear hormone receptors (PMID: 10809664). N-CoR and SMRT play an active role in the recruitment of HDAC3 to binding sites as well as directly regulating HDAC3 activity. Additionally, HDAC3 targets growth-regulated genes.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for HDAC3 antibody 10255-1-AP | Download protocol |
IHC protocol for HDAC3 antibody 10255-1-AP | Download protocol |
IF protocol for HDAC3 antibody 10255-1-AP | Download protocol |
IP protocol for HDAC3 antibody 10255-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Acta Pharm Sin B Histone deacetylase inhibitors inhibit cervical cancer growth through Parkin acetylation-mediated mitophagy. | ||
J Clin Invest Acetaldehyde dehydrogenase 2 interactions with LDLR and AMPK regulate foam cell formation. | ||
Mol Ther Genetic and Pharmacological Inhibition of GRPR Protects Against Acute Kidney Injury via Attenuating Renal Inflammation and Necroptosis | ||
J Exp Med Nuclear DEK preserves hematopoietic stem cells potential via NCoR1/HDAC3-Akt1/2-mTOR axis. | ||
J Hazard Mater Epigenetic reprogramming of HDAC2 in CA1 excitatory neurons determines Pb-induced non-spatial memory deficits | ||
Cell Rep Gut microbiota shapes social dominance through modulating HDAC2 in the medial prefrontal cortex. |