• Featured Product
  • KD/KO Validated

HDAC3 Polyclonal antibody

HDAC3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10255-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA

EC:3.5.1.-, EC:3.5.1.98, HDAC 3, Histone deacetylase 3, Protein deacetylase HDAC3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, A431 cells, HAP1 cells, HL-60 cells, U-251 cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, bEnd.3 cells, NIH/3T3 cells, C6 cells, mouse testis tissue, rat testis tissue
Positive IP detected inA431 cells
Positive IHC detected inhuman ovary tumor tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inK-562 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10255-1-AP targets HDAC3 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0396

Product name: Recombinant human HDAC3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 187-395 aa of BC000614

Sequence: VMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADA

Predict reactive species
Full Name histone deacetylase 3
Calculated Molecular Weight 49 kDa
Observed Molecular Weight 49 kDa
GenBank Accession NumberBC000614
Gene Symbol HDAC3
Gene ID (NCBI) 8841
RRIDAB_2279733
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO15379
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

What is the molecular weight of HDAC3? Is HDAC3 post-translationally modified?

The molecular weight of HDAC3 is 49 kDa but HDAC3 can form homodimers and homotrimers in cells (PMID: 11779848). HDAC3 can be phosphorylated at S424 residue by protein kinase CK2, which regulates HDAC3 activity (PMID: 15805470).

 What is the subcellular localization of HDAC3?

Unlike other class I HDACs, HDAC3 actively shuttles between the nucleus and cytoplasm (PMID: 11779848). Additionally, HDAC3 can be present at the plasma membrane, where it associates with c-Src (PMID: 16532030).

 What is the tissue expression pattern of HDAC3?

Like other class I HDACs, HDAC3 is ubiquitously expressed (PMID: 9346952).

 What is the mechanism of HDAC3 in regulating gene expression?

Unlike other histone deacetylates, it exists in a complex with two proteins - nuclear receptor co-repressor (N-CoR) and silencing mediator for retinoid and thyroid receptors (SMRT) - and therefore acts as a mediator of the repression function of unliganded nuclear hormone receptors (PMID: 10809664). N-CoR and SMRT play an active role in the recruitment of HDAC3 to binding sites as well as directly regulating HDAC3 activity. Additionally, HDAC3 targets growth-regulated genes.


Protocols

Product Specific Protocols
IF protocol for HDAC3 antibody 10255-1-APDownload protocol
IHC protocol for HDAC3 antibody 10255-1-APDownload protocol
IP protocol for HDAC3 antibody 10255-1-APDownload protocol
WB protocol for HDAC3 antibody 10255-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Acta Pharm Sin B

Histone deacetylase inhibitors inhibit cervical cancer growth through Parkin acetylation-mediated mitophagy.

Authors - Xin Sun
mouseWB

J Clin Invest

Acetaldehyde dehydrogenase 2 interactions with LDLR and AMPK regulate foam cell formation.

Authors - Shanshan Zhong
humanWB

Mol Ther

Genetic and Pharmacological Inhibition of GRPR Protects Against Acute Kidney Injury via Attenuating Renal Inflammation and Necroptosis

Authors - Chao Li
mouseWB

J Exp Med

Nuclear DEK preserves hematopoietic stem cells potential via NCoR1/HDAC3-Akt1/2-mTOR axis.

Authors - Zhe Chen
mouseWB

J Hazard Mater

Epigenetic reprogramming of HDAC2 in CA1 excitatory neurons determines Pb-induced non-spatial memory deficits

Authors - Mengmeng Wang
ratWB

Cell Rep

Gut microbiota shapes social dominance through modulating HDAC2 in the medial prefrontal cortex.

Authors - Tian Wang
Loading...
||
New chat

Able

正在加载,请稍候...