Tested Applications
| Positive WB detected in | HEK-293T cells, HeLa cells, Jurkat cells |
| Positive IHC detected in | human ovary tumor tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
29252-1-AP targets HDAC4 in WB, IHC, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30752 Product name: Recombinant human HDAC4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 888-972 aa of BC039904 Sequence: LPEKVLQQRPNANAVRSMEKVMEIHSKYWRCLQRTTSTAGRSLIEAQTCENEEAETVTAMASLSVGVKPAEKRPDEEPMEEEPPL Predict reactive species |
| Full Name | histone deacetylase 4 |
| Calculated Molecular Weight | 972 aa, 106 kDa |
| Observed Molecular Weight | 120-140 kDa |
| GenBank Accession Number | BC039904 |
| Gene Symbol | HDAC4 |
| Gene ID (NCBI) | 9759 |
| RRID | AB_3086107 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P56524 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HDAC4 (Histone deacetylase 4) belongs to class II of the histone deacetylase/acuc/apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. Histone deacetylation gives a tag for epigenetic repression and plays a role in transcriptional regulation, cell cycle progression and developmental events. It is involved in muscle maturation by its interaction with the myocyte enhancer factors such as MEF2A, MEF2C and MEF2D. HDAC4 is required for TGFbeta1-induced myofibroblastic differentiation (PMID: 17610967). HDAC4 encoded by an allele associated with mental retardation is a gain-of-function nuclear repressor that abolishes transcription and synaptic transmission (PMID: 23141539).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for HDAC4 antibody 29252-1-AP | Download protocol |
| WB protocol for HDAC4 antibody 29252-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









